Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8962
Gene name
LocationContig_62:3224..4801
Strand-
Gene length (bp)1577
Transcript length (bp)1509
Coding sequence length (bp)1509
Protein length (aa) 503

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01853 MOZ_SAS MOZ/SAS family 1.7E-81 277 456
PF17772 zf-MYST MYST family zinc finger domain 9.8E-21 218 272
PF11717 Tudor-knot RNA binding activity-knot of a chromodomain 3.8E-17 29 80

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S9B6|ESA1_NEUCR Histone acetyltransferase esa-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=esa-1 PE=3 SV=1 1 502 0.0E+00
sp|C8VBH4|ESA1_EMENI Histone acetyltransferase esa1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=esa1 PE=3 SV=1 8 502 0.0E+00
sp|Q2UMQ5|ESA1_ASPOR Histone acetyltransferase ESA1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=esa1 PE=3 SV=1 8 502 0.0E+00
sp|Q4IEV4|ESA1_GIBZE Histone acetyltransferase ESA1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ESA1 PE=3 SV=1 1 502 0.0E+00
sp|Q4WHG1|ESA1_ASPFU Histone acetyltransferase esa1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=esa1 PE=3 SV=1 38 502 4.0E-175
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S9B6|ESA1_NEUCR Histone acetyltransferase esa-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=esa-1 PE=3 SV=1 1 502 0.0E+00
sp|C8VBH4|ESA1_EMENI Histone acetyltransferase esa1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=esa1 PE=3 SV=1 8 502 0.0E+00
sp|Q2UMQ5|ESA1_ASPOR Histone acetyltransferase ESA1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=esa1 PE=3 SV=1 8 502 0.0E+00
sp|Q4IEV4|ESA1_GIBZE Histone acetyltransferase ESA1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ESA1 PE=3 SV=1 1 502 0.0E+00
sp|Q4WHG1|ESA1_ASPFU Histone acetyltransferase esa1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=esa1 PE=3 SV=1 38 502 4.0E-175
sp|O94446|ESA1_SCHPO Histone acetyltransferase mst1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mst1 PE=1 SV=1 38 502 2.0E-165
sp|Q6C710|ESA1_YARLI Histone acetyltransferase ESA1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ESA1 PE=3 SV=1 4 502 3.0E-161
sp|Q6FPH9|ESA1_CANGA Histone acetyltransferase ESA1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ESA1 PE=3 SV=1 6 502 2.0E-159
sp|Q75BY2|ESA1_ASHGO Histone acetyltransferase ESA1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ESA1 PE=3 SV=2 15 502 2.0E-159
sp|Q08649|ESA1_YEAST Histone acetyltransferase ESA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESA1 PE=1 SV=1 12 502 1.0E-156
sp|P0CP02|ESA1_CRYNJ Histone acetyltransferase ESA1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ESA1 PE=3 SV=1 2 502 8.0E-152
sp|P0CP03|ESA1_CRYNB Histone acetyltransferase ESA1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ESA1 PE=3 SV=1 2 502 8.0E-152
sp|Q6CKE9|ESA1_KLULA Histone acetyltransferase ESA1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ESA1 PE=3 SV=1 26 502 1.0E-150
sp|Q6BU95|ESA1_DEBHA Histone acetyltransferase ESA1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ESA1 PE=3 SV=2 22 502 3.0E-143
sp|Q4P3S3|ESA1_USTMA Histone acetyltransferase ESA1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ESA1 PE=3 SV=1 31 502 8.0E-140
sp|Q5A7Q2|ESA1_CANAL Histone acetyltransferase ESA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ESA1 PE=3 SV=1 22 419 2.0E-131
sp|Q5RBG4|KAT5_PONAB Histone acetyltransferase KAT5 OS=Pongo abelii GN=KAT5 PE=2 SV=1 45 490 8.0E-115
sp|Q99MK2|KAT5_RAT Histone acetyltransferase KAT5 OS=Rattus norvegicus GN=Kat5 PE=1 SV=2 45 490 1.0E-113
sp|Q8CHK4|KAT5_MOUSE Histone acetyltransferase KAT5 OS=Mus musculus GN=Kat5 PE=1 SV=2 45 490 1.0E-113
sp|Q92993|KAT5_HUMAN Histone acetyltransferase KAT5 OS=Homo sapiens GN=KAT5 PE=1 SV=2 45 490 2.0E-113
sp|Q960X4|TIP60_DROME Histone acetyltransferase Tip60 OS=Drosophila melanogaster GN=Tip60 PE=1 SV=1 45 490 6.0E-112
sp|Q9TYU5|TIP60_CAEEL Histone acetyltransferase Tip60 homolog OS=Caenorhabditis elegans GN=mys-1 PE=2 SV=1 17 490 8.0E-110
sp|Q810T5|KAT7_RAT Histone acetyltransferase KAT7 OS=Rattus norvegicus GN=Kat7 PE=1 SV=1 197 491 6.0E-96
sp|Q5SVQ0|KAT7_MOUSE Histone acetyltransferase KAT7 OS=Mus musculus GN=Kat7 PE=1 SV=1 197 491 6.0E-96
sp|O95251|KAT7_HUMAN Histone acetyltransferase KAT7 OS=Homo sapiens GN=KAT7 PE=1 SV=1 197 491 8.0E-96
sp|Q9LXD7|MYST2_ARATH Histone acetyltransferase of the MYST family 2 OS=Arabidopsis thaliana GN=HAM2 PE=1 SV=1 214 490 3.0E-93
sp|Q9FLF7|MYST1_ARATH Histone acetyltransferase of the MYST family 1 OS=Arabidopsis thaliana GN=HAM1 PE=1 SV=1 214 490 2.0E-92
sp|Q8LI34|MYST1_ORYSJ Putative MYST-like histone acetyltransferase 1 OS=Oryza sativa subsp. japonica GN=Os07g0626600 PE=3 SV=1 214 490 4.0E-92
sp|Q9H7Z6|KAT8_HUMAN Histone acetyltransferase KAT8 OS=Homo sapiens GN=KAT8 PE=1 SV=2 204 491 4.0E-91
sp|Q9D1P2|KAT8_MOUSE Histone acetyltransferase KAT8 OS=Mus musculus GN=Kat8 PE=1 SV=1 204 491 7.0E-91
sp|Q5XI06|KAT8_RAT Histone acetyltransferase KAT8 OS=Rattus norvegicus GN=Kat8 PE=1 SV=1 204 491 9.0E-91
sp|O02193|MOF_DROME Males-absent on the first protein OS=Drosophila melanogaster GN=mof PE=1 SV=1 33 501 3.0E-84
sp|Q5TKR9|KAT6A_RAT Histone acetyltransferase KAT6A OS=Rattus norvegicus GN=Kat6a PE=1 SV=2 217 496 1.0E-82
sp|Q92794|KAT6A_HUMAN Histone acetyltransferase KAT6A OS=Homo sapiens GN=KAT6A PE=1 SV=2 217 496 2.0E-82
sp|Q8BZ21|KAT6A_MOUSE Histone acetyltransferase KAT6A OS=Mus musculus GN=Kat6a PE=1 SV=2 217 496 2.0E-82
sp|Q8WYB5|KAT6B_HUMAN Histone acetyltransferase KAT6B OS=Homo sapiens GN=KAT6B PE=1 SV=3 219 497 4.0E-81
sp|Q8WML3|KAT6B_MACFA Histone acetyltransferase KAT6B OS=Macaca fascicularis GN=KAT6B PE=2 SV=1 219 497 9.0E-81
sp|Q8BRB7|KAT6B_MOUSE Histone acetyltransferase KAT6B OS=Mus musculus GN=Kat6b PE=1 SV=3 219 494 1.0E-80
sp|Q10325|MST2_SCHPO Histone acetyltransferase mst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mst2 PE=1 SV=1 220 462 5.0E-80
sp|P34218|SAS3_YEAST Histone acetyltransferase SAS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAS3 PE=1 SV=1 213 456 2.0E-70
sp|P40963|SAS2_YEAST Histone acetyltransferase SAS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAS2 PE=1 SV=1 219 456 8.0E-41
sp|Q5A7Q2|ESA1_CANAL Histone acetyltransferase ESA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ESA1 PE=3 SV=1 423 502 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016573 histone acetylation Yes
GO:0004402 histone acetyltransferase activity Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0008152 metabolic process No
GO:0010468 regulation of gene expression No
GO:0043543 protein acylation No
GO:0016410 N-acyltransferase activity No
GO:0071704 organic substance metabolic process No
GO:0016407 acetyltransferase activity No
GO:0006473 protein acetylation No
GO:0019222 regulation of metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0050794 regulation of cellular process No
GO:0016570 histone modification No
GO:0018205 peptidyl-lysine modification No
GO:0044267 cellular protein metabolic process No
GO:0044238 primary metabolic process No
GO:0006475 internal protein amino acid acetylation No
GO:0008150 biological_process No
GO:0051252 regulation of RNA metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0008080 N-acetyltransferase activity No
GO:0009889 regulation of biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0036211 protein modification process No
GO:0018394 peptidyl-lysine acetylation No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0060255 regulation of macromolecule metabolic process No
GO:0050789 regulation of biological process No
GO:0018393 internal peptidyl-lysine acetylation No
GO:0006464 cellular protein modification process No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0018193 peptidyl-amino acid modification No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0016569 covalent chromatin modification No
GO:0034212 peptide N-acetyltransferase activity No
GO:0016747 transferase activity, transferring acyl groups other than amino-acyl groups No
GO:0003824 catalytic activity No
GO:0016043 cellular component organization No
GO:0071840 cellular component organization or biogenesis No
GO:0031326 regulation of cellular biosynthetic process No
GO:0019538 protein metabolic process No
GO:0016746 transferase activity, transferring acyl groups No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0006325 chromatin organization No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0061733 peptide-lysine-N-acetyltransferase activity No
GO:0043412 macromolecule modification No
GO:0031323 regulation of cellular metabolic process No
GO:0065007 biological regulation No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8962
MTPGTTGGEAAVGSDAPREKGKATPDTLRSGCIAWVEKEGQPRRAEILSIKETKSGKQFYCNFDNFNKRLDEWVP
VARIDFSQDVEWPNPEKEKLKDSKSKKSSSTQTKKAQVSKKSQKRPAKREQSVHSEATTPHPWTEFVESSRQRKS
SSIGPDGDTQAYTSVEASATPAAVEDVDPDDREEDKRKEAGGFSREEEIEKLRTSGSMTQNPAEISRIRNISKVQ
FGKNDLFPWYFSPYPEMFSHEDVIFICEFCLSYYGDERAFLRHRKKCLLQHPPGNEIYRDDYVSFFEIDGRRQRT
WCRNLCLLSKMFLDHKTLYYDVDPFLFYVMTTRSDKGCHIVGYFSKEKESADGYNVACILTLPQYQRKGYGRLLI
QFSYELSKIEGKLGSPEKPLSDLGLLSYRQYWSENILDLLLGFNERDDKVTIETISSALAMTTQDVEHTLQAMKM
QVYHKSDHKIVIPDRLIKQREKQKEKQKRILDAARIQWKPPVFTASSRTWGW*
Coding >Hirsu2|8962
ATGACTCCTGGAACGACAGGCGGCGAAGCGGCTGTCGGGTCGGACGCCCCCCGAGAAAAGGGAAAAGCAACTCCT
GATACTCTCAGATCGGGCTGTATTGCTTGGGTCGAGAAGGAAGGCCAACCGCGCAGAGCTGAGATCCTCAGCATC
AAAGAAACCAAGAGCGGCAAACAGTTTTATTGCAACTTTGATAACTTCAACAAGCGACTTGATGAATGGGTTCCC
GTCGCCAGGATTGACTTCAGCCAGGACGTCGAGTGGCCGAACCCCGAGAAGGAGAAGTTGAAGGATTCCAAGTCC
AAGAAATCATCTTCAACGCAGACGAAAAAGGCCCAGGTTTCGAAGAAGTCACAAAAGCGTCCCGCCAAAAGGGAA
CAGTCAGTTCATTCCGAGGCTACAACTCCTCATCCATGGACAGAGTTTGTTGAGTCTTCCAGGCAACGGAAATCA
TCATCGATCGGACCTGATGGCGATACTCAGGCATACACCAGTGTCGAAGCCAGTGCCACACCGGCTGCTGTCGAA
GATGTGGACCCAGACGACAGAGAAGAGGACAAACGAAAGGAAGCAGGCGGATTTAGTCGCGAGGAAGAGATTGAG
AAACTGAGAACATCTGGCTCTATGACGCAAAATCCGGCCGAAATTTCGCGCATACGAAACATCTCAAAGGTTCAG
TTCGGGAAGAATGACTTGTTTCCGTGGTACTTCTCGCCGTATCCCGAGATGTTCAGCCACGAGGATGTTATATTC
ATTTGCGAGTTCTGCTTGAGCTACTATGGAGACGAGAGAGCTTTCCTCCGTCATCGGAAAAAATGCTTGCTGCAG
CATCCTCCGGGCAACGAAATTTATCGAGACGACTACGTGTCCTTCTTCGAGATCGATGGGCGCCGCCAACGAACC
TGGTGCCGGAATCTCTGTCTGCTATCTAAAATGTTCCTCGATCACAAGACGTTATACTACGACGTCGACCCATTC
CTATTCTACGTCATGACAACACGAAGCGACAAGGGCTGTCATATAGTGGGCTACTTTTCCAAGGAGAAGGAGAGC
GCGGACGGATACAACGTCGCTTGTATTCTGACCCTCCCCCAGTACCAGAGAAAGGGGTATGGCAGGCTACTTATC
CAATTTTCCTACGAGCTATCCAAAATCGAGGGCAAGCTAGGGTCGCCAGAAAAGCCACTATCTGACCTGGGGCTA
CTAAGTTACCGCCAGTACTGGTCGGAAAATATTCTCGATCTTCTGCTTGGTTTCAATGAACGAGACGACAAGGTG
ACGATTGAGACAATCTCCTCGGCTCTGGCCATGACGACGCAGGATGTCGAGCACACTCTTCAGGCGATGAAGATG
CAAGTGTACCACAAGAGCGACCACAAGATCGTCATCCCAGACAGACTCATCAAGCAAAGGGAGAAGCAAAAGGAA
AAACAAAAGAGGATTCTTGACGCGGCGAGGATACAATGGAAACCGCCGGTATTCACGGCCTCGAGTCGGACGTGG
GGCTGGTGA
Transcript >Hirsu2|8962
ATGACTCCTGGAACGACAGGCGGCGAAGCGGCTGTCGGGTCGGACGCCCCCCGAGAAAAGGGAAAAGCAACTCCT
GATACTCTCAGATCGGGCTGTATTGCTTGGGTCGAGAAGGAAGGCCAACCGCGCAGAGCTGAGATCCTCAGCATC
AAAGAAACCAAGAGCGGCAAACAGTTTTATTGCAACTTTGATAACTTCAACAAGCGACTTGATGAATGGGTTCCC
GTCGCCAGGATTGACTTCAGCCAGGACGTCGAGTGGCCGAACCCCGAGAAGGAGAAGTTGAAGGATTCCAAGTCC
AAGAAATCATCTTCAACGCAGACGAAAAAGGCCCAGGTTTCGAAGAAGTCACAAAAGCGTCCCGCCAAAAGGGAA
CAGTCAGTTCATTCCGAGGCTACAACTCCTCATCCATGGACAGAGTTTGTTGAGTCTTCCAGGCAACGGAAATCA
TCATCGATCGGACCTGATGGCGATACTCAGGCATACACCAGTGTCGAAGCCAGTGCCACACCGGCTGCTGTCGAA
GATGTGGACCCAGACGACAGAGAAGAGGACAAACGAAAGGAAGCAGGCGGATTTAGTCGCGAGGAAGAGATTGAG
AAACTGAGAACATCTGGCTCTATGACGCAAAATCCGGCCGAAATTTCGCGCATACGAAACATCTCAAAGGTTCAG
TTCGGGAAGAATGACTTGTTTCCGTGGTACTTCTCGCCGTATCCCGAGATGTTCAGCCACGAGGATGTTATATTC
ATTTGCGAGTTCTGCTTGAGCTACTATGGAGACGAGAGAGCTTTCCTCCGTCATCGGAAAAAATGCTTGCTGCAG
CATCCTCCGGGCAACGAAATTTATCGAGACGACTACGTGTCCTTCTTCGAGATCGATGGGCGCCGCCAACGAACC
TGGTGCCGGAATCTCTGTCTGCTATCTAAAATGTTCCTCGATCACAAGACGTTATACTACGACGTCGACCCATTC
CTATTCTACGTCATGACAACACGAAGCGACAAGGGCTGTCATATAGTGGGCTACTTTTCCAAGGAGAAGGAGAGC
GCGGACGGATACAACGTCGCTTGTATTCTGACCCTCCCCCAGTACCAGAGAAAGGGGTATGGCAGGCTACTTATC
CAATTTTCCTACGAGCTATCCAAAATCGAGGGCAAGCTAGGGTCGCCAGAAAAGCCACTATCTGACCTGGGGCTA
CTAAGTTACCGCCAGTACTGGTCGGAAAATATTCTCGATCTTCTGCTTGGTTTCAATGAACGAGACGACAAGGTG
ACGATTGAGACAATCTCCTCGGCTCTGGCCATGACGACGCAGGATGTCGAGCACACTCTTCAGGCGATGAAGATG
CAAGTGTACCACAAGAGCGACCACAAGATCGTCATCCCAGACAGACTCATCAAGCAAAGGGAGAAGCAAAAGGAA
AAACAAAAGAGGATTCTTGACGCGGCGAGGATACAATGGAAACCGCCGGTATTCACGGCCTCGAGTCGGACGTGG
GGCTGGTGA
Gene >Hirsu2|8962
ATGACTCCTGGAACGACAGGCGGCGAAGCGGCTGTCGGGTCGGACGCCCCCCGAGAAAAGGGAAAAGCAACTCCT
GATACTCTCAGATCGGGCTGTATTGCTTGGGTCGAGAAGGAAGGCCAACCGCGCAGAGCTGAGATCCTCAGCATC
AAAGAAACCAAGAGCGGCAAACAGTTTTATTGCAACTTTGATAACTTCAACAAGCGACTTGATGAATGGGTTCCC
GTCGCCAGGATTGACTTCAGCCAGGACGTCGAGTGGCCGAACCCCGAGAAGGAGAAGTTGAAGGATTCCAAGTCC
AAGAAATCATCTTCAACGCAGACGAAAAAGGCCCAGGTTTCGAAGAAGTCACAAAAGCGTCCCGCCAAAAGGGAA
CAGTCAGTTCATTCCGAGGCTACAACTCCTCATCCATGGACAGGTTCGCAAGACATCATTTCTTTTTTTGGACAA
AATGGCGAGCATATCCGCTAACAGCATCGCGCGCAGAGTTTGTTGAGTCTTCCAGGCAACGGAAATCATCATCGA
TCGGACCTGATGGCGATACTCAGGCATACACCAGTGTCGAAGCCAGTGCCACACCGGCTGCTGTCGAAGATGTGG
ACCCAGACGACAGAGAAGAGGACAAACGAAAGGAAGCAGGCGGATTTAGTCGCGAGGAAGAGATTGAGAAACTGA
GAACATCTGGCTCTATGACGCAAAATCCGGCCGAAATTTCGCGCATACGAAACATCTCAAAGGTTCAGTTCGGGA
AGAATGACTTGTTTCCGTGGTACTTCTCGCCGTATCCCGAGATGTTCAGCCACGAGGATGTTATATTCATTTGCG
AGTTCTGCTTGAGCTACTATGGAGACGAGAGAGCTTTCCTCCGTCATCGGAAAAAATGCTTGCTGCAGCATCCTC
CGGGCAACGAAATTTATCGAGACGACTACGTGTCCTTCTTCGAGATCGATGGGCGCCGCCAACGAACCTGGTGCC
GGAATCTCTGTCTGCTATCTAAAATGTTCCTCGATCACAAGACGTTATACTACGACGTCGACCCATTCCTATTCT
ACGTCATGACAACACGAAGCGACAAGGGCTGTCATATAGTGGGCTACTTTTCCAAGGAGAAGGAGAGCGCGGACG
GATACAACGTCGCTTGTATTCTGACCCTCCCCCAGTACCAGAGAAAGGGGTATGGCAGGCTACTTATCCAATTTT
CCTACGAGCTATCCAAAATCGAGGGCAAGCTAGGGTCGCCAGAAAAGCCACTATCTGACCTGGGGCTACTAAGTT
ACCGCCAGTACTGGTCGGAAAATATTCTCGATCTTCTGCTTGGTTTCAATGAACGAGACGACAAGGTGACGATTG
AGACAATCTCCTCGGCTCTGGCCATGACGACGCAGGATGTCGAGCACACTCTTCAGGCGATGAAGATGCAAGTGT
ACCACAAGAGCGACCACAAGATCGTCATCCCAGACAGACTCATCAAGCAAAGGGAGAAGCAAAAGGAAAAACAAA
AGAGGATTCTTGACGCGGCGAGGATACAATGGAAACCGCCGGTATTCACGGCCTCGAGTCGGACGTGGGGCTGGT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail