Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8947
Gene name
LocationContig_617:176..588
Strand-
Gene length (bp)412
Transcript length (bp)372
Coding sequence length (bp)372
Protein length (aa) 124

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10300 DUF3808 Protein of unknown function (DUF3808) 5.5E-08 48 115

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H2B2|IML2_CHAGB Mitochondrial outer membrane protein IML2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=IML2 PE=3 SV=1 17 113 2.0E-11
sp|Q7SA06|IML2_NEUCR Mitochondrial outer membrane protein iml-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=iml-2 PE=3 SV=1 30 113 5.0E-10
sp|A2QQE8|IML2_ASPNC Mitochondrial outer membrane protein iml2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=iml2 PE=3 SV=1 37 118 4.0E-09
sp|Q4WT68|IML2_ASPFU Mitochondrial outer membrane protein iml2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=iml2 PE=3 SV=2 37 118 1.0E-08
sp|B0XQF6|IML2_ASPFC Mitochondrial outer membrane protein iml2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=iml2 PE=3 SV=1 37 118 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H2B2|IML2_CHAGB Mitochondrial outer membrane protein IML2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=IML2 PE=3 SV=1 17 113 2.0E-11
sp|Q7SA06|IML2_NEUCR Mitochondrial outer membrane protein iml-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=iml-2 PE=3 SV=1 30 113 5.0E-10
sp|A2QQE8|IML2_ASPNC Mitochondrial outer membrane protein iml2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=iml2 PE=3 SV=1 37 118 4.0E-09
sp|Q4WT68|IML2_ASPFU Mitochondrial outer membrane protein iml2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=iml2 PE=3 SV=2 37 118 1.0E-08
sp|B0XQF6|IML2_ASPFC Mitochondrial outer membrane protein iml2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=iml2 PE=3 SV=1 37 118 1.0E-08
sp|Q0D1F8|IML2_ASPTN Mitochondrial outer membrane protein iml2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=iml2 PE=3 SV=1 38 118 3.0E-08
sp|A7E727|IML2_SCLS1 Mitochondrial outer membrane protein iml2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=iml2 PE=3 SV=1 22 113 2.0E-07
sp|A1CQ80|IML2_ASPCL Mitochondrial outer membrane protein iml2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=iml2 PE=3 SV=1 49 120 4.0E-07
sp|A1D345|IML2_NEOFI Mitochondrial outer membrane protein iml2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=iml2 PE=3 SV=1 49 118 8.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8947
MGPLSLLFRSASGRTDSPADSKEAVEQREAAAARQRRELEDASEWIGRFMNDDVDVAYEKLQAGDSAFHSLGLAF
ASFLRCLIGLDKQTLAETAAKLDRLETRAAADAKAAQQTNPRPASPRC*
Coding >Hirsu2|8947
ATGGGCCCCCTCAGCCTCCTGTTCCGCTCCGCCAGCGGCCGCACCGACAGCCCGGCCGACAGCAAGGAGGCCGTC
GAGCAGCGCGAGGCGGCCGCGGCCCGGCAGCGGAGGGAGCTGGAGGACGCGTCGGAGTGGATCGGCCGCTTCATG
AACGACGACGTGGACGTGGCCTACGAAAAGCTGCAGGCCGGCGACTCGGCCTTCCACAGCCTGGGCCTGGCCTTC
GCCTCCTTCCTGCGCTGCCTCATCGGGCTCGACAAGCAGACGCTGGCCGAGACGGCCGCCAAGCTGGACCGCCTC
GAGACCAGGGCCGCCGCCGACGCCAAGGCCGCCCAGCAGACGAACCCGCGGCCCGCCAGCCCACGCTGCTGA
Transcript >Hirsu2|8947
ATGGGCCCCCTCAGCCTCCTGTTCCGCTCCGCCAGCGGCCGCACCGACAGCCCGGCCGACAGCAAGGAGGCCGTC
GAGCAGCGCGAGGCGGCCGCGGCCCGGCAGCGGAGGGAGCTGGAGGACGCGTCGGAGTGGATCGGCCGCTTCATG
AACGACGACGTGGACGTGGCCTACGAAAAGCTGCAGGCCGGCGACTCGGCCTTCCACAGCCTGGGCCTGGCCTTC
GCCTCCTTCCTGCGCTGCCTCATCGGGCTCGACAAGCAGACGCTGGCCGAGACGGCCGCCAAGCTGGACCGCCTC
GAGACCAGGGCCGCCGCCGACGCCAAGGCCGCCCAGCAGACGAACCCGCGGCCCGCCAGCCCACGCTGCTGA
Gene >Hirsu2|8947
ATGGGCCCCCTCAGCCTCCTGTTCCGCTCCGCCAGCGGCCGCACCGACAGCCCGGCCGACAGCAAGGAGGCCGTC
GAGCAGCGCGAGGCGGCCGCGGCCCGGCAGCGGAGGGAGCTGGAGGACGCGTCGGAGTGGATCGGCCGCTTCATG
AACGACGACGTGGACGTGGCCTACGAAAAGCTGCAGGCCGGCGACTCGGCCTTCCACAGCCTGGGCCTGGCCTTC
GCCTCCTTCCTGCGCTGCCTCATCGGGCTCGACAAGCAGACGCTGGCCGAGACGGCCGCCAAGCTGGACCGCCTC
GAGACCAGGGCCGCCGCCGACGCCAAGGCCGCCCAGCAGACGAACCCGCGGCCCGCCAGCCCGTACCCGCCCGGC
ACCGAGTACGAGCTGATCCGGGCCGAGACGCTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail