Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8945
Gene name
LocationContig_616:5309..9741
Strand+
Gene length (bp)4432
Transcript length (bp)3429
Coding sequence length (bp)3429
Protein length (aa) 1143

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12157 DUF3591 Protein of unknown function (DUF3591) 4.8E-177 432 915

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09813|T111_SCHPO Putative transcription initiation factor TFIID 111 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.14 PE=1 SV=1 383 1111 3.0E-152
sp|P46677|TAF1_YEAST Transcription initiation factor TFIID subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF1 PE=1 SV=1 172 1110 4.0E-128
sp|P51123|TAF1_DROME Transcription initiation factor TFIID subunit 1 OS=Drosophila melanogaster GN=Taf1 PE=1 SV=3 432 861 2.0E-46
sp|Q60544|TAF1_MESAU Transcription initiation factor TFIID subunit 1 OS=Mesocricetus auratus GN=TAF1 PE=2 SV=1 387 861 4.0E-45
sp|P21675|TAF1_HUMAN Transcription initiation factor TFIID subunit 1 OS=Homo sapiens GN=TAF1 PE=1 SV=2 432 861 5.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09813|T111_SCHPO Putative transcription initiation factor TFIID 111 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.14 PE=1 SV=1 383 1111 3.0E-152
sp|P46677|TAF1_YEAST Transcription initiation factor TFIID subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF1 PE=1 SV=1 172 1110 4.0E-128
sp|P51123|TAF1_DROME Transcription initiation factor TFIID subunit 1 OS=Drosophila melanogaster GN=Taf1 PE=1 SV=3 432 861 2.0E-46
sp|Q60544|TAF1_MESAU Transcription initiation factor TFIID subunit 1 OS=Mesocricetus auratus GN=TAF1 PE=2 SV=1 387 861 4.0E-45
sp|P21675|TAF1_HUMAN Transcription initiation factor TFIID subunit 1 OS=Homo sapiens GN=TAF1 PE=1 SV=2 432 861 5.0E-45
sp|Q80UV9|TAF1_MOUSE Transcription initiation factor TFIID subunit 1 OS=Mus musculus GN=Taf1 PE=1 SV=2 387 861 4.0E-44
sp|Q8IZX4|TAF1L_HUMAN Transcription initiation factor TFIID subunit 1-like OS=Homo sapiens GN=TAF1L PE=1 SV=1 432 861 5.0E-44
sp|Q54DH8|TAF1_DICDI Transcription initiation factor TFIID subunit 1 OS=Dictyostelium discoideum GN=taf1 PE=3 SV=1 431 861 1.0E-38
sp|G5EGM3|TAF1_CAEEL Transcription initiation factor TFIID subunit 1 OS=Caenorhabditis elegans GN=taf-1 PE=2 SV=1 432 861 2.0E-38
sp|Q8LRK9|TAF1_ARATH Transcription initiation factor TFIID subunit 1 OS=Arabidopsis thaliana GN=TAF1 PE=1 SV=1 521 857 2.0E-31
sp|Q67W65|TAF1_ORYSJ Transcription initiation factor TFIID subunit 1 OS=Oryza sativa subsp. japonica GN=TAF1 PE=2 SV=1 521 862 5.0E-29
sp|Q6PUA2|TAF1B_ARATH Transcription initiation factor TFIID subunit 1b OS=Arabidopsis thaliana GN=TAF1B PE=2 SV=1 521 861 8.0E-29
sp|P51123|TAF1_DROME Transcription initiation factor TFIID subunit 1 OS=Drosophila melanogaster GN=Taf1 PE=1 SV=3 971 1113 2.0E-09
sp|G5EGM3|TAF1_CAEEL Transcription initiation factor TFIID subunit 1 OS=Caenorhabditis elegans GN=taf-1 PE=2 SV=1 963 1110 7.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2089 0.8833 0.0818 0.0317 0.0299 0.0032 0.0513 0.0163 0.0329 0.0019

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4351
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3921
Ophiocordyceps australis map64 (Brazil) OphauB2|6301
Ophiocordyceps camponoti-floridani Ophcf2|02459
Ophiocordyceps camponoti-rufipedis Ophun1|3747
Ophiocordyceps kimflemingae Ophio5|4699
Ophiocordyceps subramaniannii Hirsu2|8945 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8945
MSDNENDFSSRDENAWKAQDAADEREIARLLEQSQEGGNGGLTLDDTPFDQTNKADDAQDFEDISDDDLPDEEEP
SAGNSLEIPGLTDDGGTSNDADDLFGEGPSSPTDPILGPSSPAPQVHDVDAAEEGGAPPADAALSFTNINFDPDP
QLDARANQDPDIPAPAETVEDLLKAAWPAFRRGRILTWSELLPPKKAVWKEKKPLKKPKRLVTSKLTLELAPDQE
KQFRIPGTAAPTKRRSQNLLAGLVRCDEDAASQDGSSDRIDLDQESDSETVCGFTLRDIEMACEDWGARIEAVED
EFLAIQAREKREEELARRRHRPDDDEDDEQDAEWDAEFLQDATDEDHAQPRPKKRRAIRFGLPEIPRYTAPSFDN
FEEMTRQGAKRVQLDMSDPYLLLEMESSQHPAKRPRLEAQSKRLPNGKISRDLTQRYNLSNDESYELLKENHQSK
VRATLGNISVEHSMPAIKLTWPYYKVKLAGTTDEYHRPRFRYKKFVGHVIKFDKPHHHKRKQMKGKAHEVFMHSK
DLSMADNSTAVLFEYCEPRPRVLNNFGMGNKLINYHRRKDNKDEEQLPKQDLGEYRMLLPEDRSPFSLFGTVDVG
ETVPTLHNEMYRAPVFKHSPRATDFLVVRSTTGIEGSRWYLHKIDHLHVVGQTFPSVDVPGPHSRKVTNASKSRM
KMLAFRMIRHSQSDNCQLSDITKHIAESTDTQNRQKLKEFLQYDRDSNEKGMWRLKPGEILPDENAIRAMIKPEE
VSLLDAMQLGIKELEDAGYDPRNANIEDEQMADADGDEEDAAVDDDGSKIAKGPKKAAEKQEETLADKMAPWKTT
KAFIDACAQKAMLQLHGEGDPTGHGLGFSFIRTSMKGGYIEAVQGPLATSADAMEREKRANGGHAYNVKKQQAMY
EEGIREIWEKQRATLSDPQEHDDKDVAVTEDEDDRFNVNNASAAAAAAVAAAATPALFDEGVSQISGLTSSSRHQ
KRAIRITREVQMPDGTRQARIEVVHDPVVISQYMKRRTEADLELRDIYSSRPTGNADHDRLANLRIKKELERLEK
NKARRQAREQQKELHQKANAGDAGSPGPNGADKVPTGTTRKCANCGQVGHIKTNKKLCPLLNGTMKADQGAAEHG
GFGNYNAPAGGAGSPGA*
Coding >Hirsu2|8945
ATGAGCGACAACGAAAACGACTTCTCGTCTCGGGACGAGAACGCCTGGAAGGCCCAAGACGCGGCCGACGAGCGC
GAGATCGCGCGTCTCCTGGAGCAGAGCCAGGAGGGCGGCAACGGCGGCCTCACCCTCGACGACACGCCCTTTGAC
CAGACGAACAAAGCCGACGATGCGCAGGACTTCGAAGACATCAGCGACGACGACCTGCCCGACGAGGAGGAGCCC
AGCGCAGGCAACTCGCTCGAAATCCCAGGCCTGACCGACGACGGCGGCACTAGCAATGATGCGGACGACCTCTTC
GGCGAGGGCCCGTCGTCGCCCACCGACCCCATTCTGGGCCCGTCGTCGCCGGCGCCTCAGGTCCACGACGTCGAC
GCGGCCGAGGAAGGCGGCGCGCCGCCAGCCGATGCAGCCCTCAGCTTTACCAACATCAATTTCGATCCCGACCCG
CAGCTCGACGCCAGGGCCAACCAAGACCCCGACATCCCCGCGCCCGCCGAGACGGTCGAGGACCTGTTGAAGGCG
GCGTGGCCAGCCTTCAGGAGGGGCCGGATCCTCACCTGGAGCGAGCTGCTGCCGCCCAAGAAGGCCGTGTGGAAG
GAGAAGAAGCCGCTGAAGAAGCCCAAGCGTCTCGTGACGAGCAAGCTGACCCTCGAGCTGGCCCCCGACCAGGAG
AAACAGTTCCGCATCCCTGGGACGGCCGCCCCGACCAAACGCCGATCGCAGAATCTTCTCGCCGGTCTCGTCCGC
TGCGACGAGGACGCCGCCTCCCAAGACGGTAGTTCCGATAGGATCGACCTCGACCAAGAATCCGACTCGGAAACG
GTCTGCGGCTTCACGCTGCGCGACATAGAGATGGCTTGCGAGGACTGGGGCGCTCGCATCGAGGCCGTCGAGGAC
GAGTTCCTGGCCATCCAGGCCCGAGAAAAGAGGGAGGAGGAGCTCGCGCGCAGGCGCCACCGGCCCGACGACGAC
GAGGACGACGAGCAGGACGCCGAATGGGACGCCGAGTTTCTGCAGGACGCGACGGACGAGGACCATGCTCAGCCG
CGGCCCAAGAAGCGCAGGGCCATCCGGTTCGGCCTTCCGGAAATCCCACGGTACACGGCGCCGTCCTTTGACAAC
TTCGAGGAGATGACCCGCCAAGGCGCCAAGCGCGTCCAGCTCGACATGTCCGACCCCTACCTCCTGCTCGAGATG
GAGTCGTCGCAGCATCCGGCGAAGCGCCCCCGGCTCGAGGCCCAGTCCAAGCGCCTGCCCAACGGCAAGATCAGC
CGCGATCTGACGCAGCGATACAATCTCTCCAACGACGAGTCGTACGAGCTCCTCAAGGAGAACCACCAGAGCAAG
GTCCGGGCCACGCTCGGCAACATCTCGGTCGAGCACAGCATGCCGGCCATCAAGCTCACCTGGCCCTACTACAAG
GTCAAGCTCGCCGGCACGACGGACGAGTACCACCGACCGCGTTTCCGCTACAAGAAGTTCGTCGGCCACGTCATT
AAGTTCGACAAGCCCCATCACCACAAGCGCAAGCAGATGAAGGGCAAGGCCCACGAGGTGTTCATGCACTCCAAG
GACCTCAGCATGGCCGACAACTCGACGGCCGTGCTCTTCGAGTACTGCGAGCCCCGGCCGCGGGTGCTCAACAAC
TTTGGCATGGGCAACAAGCTCATTAACTACCACCGCCGCAAGGACAACAAGGACGAGGAGCAGCTCCCGAAGCAG
GACCTCGGCGAATACCGCATGCTCCTGCCGGAGGACCGCTCTCCCTTCTCGCTCTTCGGCACCGTCGACGTGGGC
GAGACGGTGCCGACGCTGCACAACGAGATGTACCGGGCCCCGGTCTTCAAGCACAGCCCCCGGGCCACCGACTTC
CTCGTCGTCCGCAGCACGACGGGCATCGAGGGCTCGCGCTGGTACCTGCACAAGATCGACCACCTCCACGTCGTC
GGGCAGACGTTCCCCTCGGTCGACGTGCCGGGCCCGCACAGTCGCAAGGTGACGAACGCGTCCAAGAGCAGGATG
AAGATGCTCGCCTTCCGCATGATCCGCCACAGCCAGTCGGACAACTGCCAGCTCTCGGACATCACCAAGCACATC
GCGGAGTCGACGGACACGCAGAACCGCCAGAAGCTCAAGGAATTCCTGCAGTACGACCGGGACAGCAACGAAAAG
GGCATGTGGCGTCTCAAGCCCGGGGAGATCTTGCCCGACGAGAACGCGATCCGGGCCATGATCAAGCCGGAGGAG
GTCAGCCTGCTGGACGCCATGCAGCTCGGCATCAAGGAGTTGGAGGACGCCGGGTACGATCCCCGGAACGCGAAC
ATCGAGGACGAACAGATGGCCGACGCCGACGGGGACGAGGAAGACGCGGCCGTGGACGACGACGGGAGCAAGATC
GCAAAGGGGCCCAAAAAGGCGGCGGAGAAGCAGGAGGAGACGCTGGCGGACAAGATGGCGCCGTGGAAGACGACC
AAGGCCTTCATCGACGCATGTGCCCAGAAGGCCATGCTGCAGCTGCACGGCGAGGGCGACCCGACGGGCCACGGC
CTCGGCTTCAGCTTCATCCGGACGTCGATGAAGGGCGGCTACATCGAGGCCGTCCAGGGCCCGCTGGCGACATCG
GCCGACGCCATGGAGCGGGAGAAGCGCGCCAACGGCGGGCACGCGTACAACGTCAAGAAGCAGCAGGCCATGTAC
GAGGAGGGGATCCGCGAGATATGGGAGAAGCAGAGGGCGACGCTTTCGGACCCACAGGAGCACGACGACAAGGAC
GTGGCCGTGACCGAGGACGAAGACGACCGGTTCAACGTCAACAACGCGTCGGCGGCGGCGGCGGCGGCGGTGGCG
GCGGCGGCGACGCCGGCACTGTTCGACGAGGGCGTCAGCCAGATCAGCGGGCTAACGTCGTCGAGCCGGCACCAG
AAGCGGGCGATCCGCATCACGAGGGAAGTGCAGATGCCGGACGGCACGAGGCAGGCCCGGATCGAAGTCGTCCAC
GACCCCGTCGTCATCTCGCAGTATATGAAGCGGCGCACCGAGGCGGATCTGGAGCTTCGAGACATATACAGCTCC
CGGCCTACGGGCAATGCCGACCATGACCGTCTTGCAAATCTTAGGATCAAGAAGGAACTCGAGCGACTGGAGAAG
AACAAGGCCAGACGACAAGCGCGAGAACAGCAGAAAGAGTTGCACCAGAAGGCCAACGCCGGCGACGCCGGATCC
CCCGGCCCCAACGGCGCTGACAAGGTGCCGACAGGAACGACCCGCAAGTGTGCCAATTGTGGACAGGTCGGGCAC
ATCAAAACGAATAAGAAGTTATGTCCTCTGCTCAACGGCACGATGAAGGCGGACCAGGGCGCGGCGGAGCACGGC
GGCTTTGGTAACTACAACGCCCCGGCCGGCGGCGCGGGCTCGCCAGGCGCATAG
Transcript >Hirsu2|8945
ATGAGCGACAACGAAAACGACTTCTCGTCTCGGGACGAGAACGCCTGGAAGGCCCAAGACGCGGCCGACGAGCGC
GAGATCGCGCGTCTCCTGGAGCAGAGCCAGGAGGGCGGCAACGGCGGCCTCACCCTCGACGACACGCCCTTTGAC
CAGACGAACAAAGCCGACGATGCGCAGGACTTCGAAGACATCAGCGACGACGACCTGCCCGACGAGGAGGAGCCC
AGCGCAGGCAACTCGCTCGAAATCCCAGGCCTGACCGACGACGGCGGCACTAGCAATGATGCGGACGACCTCTTC
GGCGAGGGCCCGTCGTCGCCCACCGACCCCATTCTGGGCCCGTCGTCGCCGGCGCCTCAGGTCCACGACGTCGAC
GCGGCCGAGGAAGGCGGCGCGCCGCCAGCCGATGCAGCCCTCAGCTTTACCAACATCAATTTCGATCCCGACCCG
CAGCTCGACGCCAGGGCCAACCAAGACCCCGACATCCCCGCGCCCGCCGAGACGGTCGAGGACCTGTTGAAGGCG
GCGTGGCCAGCCTTCAGGAGGGGCCGGATCCTCACCTGGAGCGAGCTGCTGCCGCCCAAGAAGGCCGTGTGGAAG
GAGAAGAAGCCGCTGAAGAAGCCCAAGCGTCTCGTGACGAGCAAGCTGACCCTCGAGCTGGCCCCCGACCAGGAG
AAACAGTTCCGCATCCCTGGGACGGCCGCCCCGACCAAACGCCGATCGCAGAATCTTCTCGCCGGTCTCGTCCGC
TGCGACGAGGACGCCGCCTCCCAAGACGGTAGTTCCGATAGGATCGACCTCGACCAAGAATCCGACTCGGAAACG
GTCTGCGGCTTCACGCTGCGCGACATAGAGATGGCTTGCGAGGACTGGGGCGCTCGCATCGAGGCCGTCGAGGAC
GAGTTCCTGGCCATCCAGGCCCGAGAAAAGAGGGAGGAGGAGCTCGCGCGCAGGCGCCACCGGCCCGACGACGAC
GAGGACGACGAGCAGGACGCCGAATGGGACGCCGAGTTTCTGCAGGACGCGACGGACGAGGACCATGCTCAGCCG
CGGCCCAAGAAGCGCAGGGCCATCCGGTTCGGCCTTCCGGAAATCCCACGGTACACGGCGCCGTCCTTTGACAAC
TTCGAGGAGATGACCCGCCAAGGCGCCAAGCGCGTCCAGCTCGACATGTCCGACCCCTACCTCCTGCTCGAGATG
GAGTCGTCGCAGCATCCGGCGAAGCGCCCCCGGCTCGAGGCCCAGTCCAAGCGCCTGCCCAACGGCAAGATCAGC
CGCGATCTGACGCAGCGATACAATCTCTCCAACGACGAGTCGTACGAGCTCCTCAAGGAGAACCACCAGAGCAAG
GTCCGGGCCACGCTCGGCAACATCTCGGTCGAGCACAGCATGCCGGCCATCAAGCTCACCTGGCCCTACTACAAG
GTCAAGCTCGCCGGCACGACGGACGAGTACCACCGACCGCGTTTCCGCTACAAGAAGTTCGTCGGCCACGTCATT
AAGTTCGACAAGCCCCATCACCACAAGCGCAAGCAGATGAAGGGCAAGGCCCACGAGGTGTTCATGCACTCCAAG
GACCTCAGCATGGCCGACAACTCGACGGCCGTGCTCTTCGAGTACTGCGAGCCCCGGCCGCGGGTGCTCAACAAC
TTTGGCATGGGCAACAAGCTCATTAACTACCACCGCCGCAAGGACAACAAGGACGAGGAGCAGCTCCCGAAGCAG
GACCTCGGCGAATACCGCATGCTCCTGCCGGAGGACCGCTCTCCCTTCTCGCTCTTCGGCACCGTCGACGTGGGC
GAGACGGTGCCGACGCTGCACAACGAGATGTACCGGGCCCCGGTCTTCAAGCACAGCCCCCGGGCCACCGACTTC
CTCGTCGTCCGCAGCACGACGGGCATCGAGGGCTCGCGCTGGTACCTGCACAAGATCGACCACCTCCACGTCGTC
GGGCAGACGTTCCCCTCGGTCGACGTGCCGGGCCCGCACAGTCGCAAGGTGACGAACGCGTCCAAGAGCAGGATG
AAGATGCTCGCCTTCCGCATGATCCGCCACAGCCAGTCGGACAACTGCCAGCTCTCGGACATCACCAAGCACATC
GCGGAGTCGACGGACACGCAGAACCGCCAGAAGCTCAAGGAATTCCTGCAGTACGACCGGGACAGCAACGAAAAG
GGCATGTGGCGTCTCAAGCCCGGGGAGATCTTGCCCGACGAGAACGCGATCCGGGCCATGATCAAGCCGGAGGAG
GTCAGCCTGCTGGACGCCATGCAGCTCGGCATCAAGGAGTTGGAGGACGCCGGGTACGATCCCCGGAACGCGAAC
ATCGAGGACGAACAGATGGCCGACGCCGACGGGGACGAGGAAGACGCGGCCGTGGACGACGACGGGAGCAAGATC
GCAAAGGGGCCCAAAAAGGCGGCGGAGAAGCAGGAGGAGACGCTGGCGGACAAGATGGCGCCGTGGAAGACGACC
AAGGCCTTCATCGACGCATGTGCCCAGAAGGCCATGCTGCAGCTGCACGGCGAGGGCGACCCGACGGGCCACGGC
CTCGGCTTCAGCTTCATCCGGACGTCGATGAAGGGCGGCTACATCGAGGCCGTCCAGGGCCCGCTGGCGACATCG
GCCGACGCCATGGAGCGGGAGAAGCGCGCCAACGGCGGGCACGCGTACAACGTCAAGAAGCAGCAGGCCATGTAC
GAGGAGGGGATCCGCGAGATATGGGAGAAGCAGAGGGCGACGCTTTCGGACCCACAGGAGCACGACGACAAGGAC
GTGGCCGTGACCGAGGACGAAGACGACCGGTTCAACGTCAACAACGCGTCGGCGGCGGCGGCGGCGGCGGTGGCG
GCGGCGGCGACGCCGGCACTGTTCGACGAGGGCGTCAGCCAGATCAGCGGGCTAACGTCGTCGAGCCGGCACCAG
AAGCGGGCGATCCGCATCACGAGGGAAGTGCAGATGCCGGACGGCACGAGGCAGGCCCGGATCGAAGTCGTCCAC
GACCCCGTCGTCATCTCGCAGTATATGAAGCGGCGCACCGAGGCGGATCTGGAGCTTCGAGACATATACAGCTCC
CGGCCTACGGGCAATGCCGACCATGACCGTCTTGCAAATCTTAGGATCAAGAAGGAACTCGAGCGACTGGAGAAG
AACAAGGCCAGACGACAAGCGCGAGAACAGCAGAAAGAGTTGCACCAGAAGGCCAACGCCGGCGACGCCGGATCC
CCCGGCCCCAACGGCGCTGACAAGGTGCCGACAGGAACGACCCGCAAGTGTGCCAATTGTGGACAGGTCGGGCAC
ATCAAAACGAATAAGAAGTTATGTCCTCTGCTCAACGGCACGATGAAGGCGGACCAGGGCGCGGCGGAGCACGGC
GGCTTTGGTAACTACAACGCCCCGGCCGGCGGCGCGGGCTCGCCAGGCGCATAG
Gene >Hirsu2|8945
ATGAGCGACAACGAAAACGACTTCTCGTCTCGGGACGAGAACGCCTGGAAGGCCCAAGACGCGGCCGACGAGCGC
GAGATCGCGCGTCTCCTGGAGCAGAGCCAGGAGGGCGGCAACGGCGGCCTCACCCTCGACGACACGCCCTTTGAC
CAGACGAACAAAGCCGACGATGCGCAGGACTTCGAAGACATCAGCGACGACGACCTGCCCGACGAGGAGGAGCCC
AGCGCAGGCAACTCGCTCGAAATCCCAGGCCTGACCGACGACGGCGGCACTAGCAATGATGCGGACGACCTCTTC
GGCGAGGGCCCGTCGTCGCCCACCGACCCCATTCTGGGCCCGTCGTCGCCGGCGCCTCAGGTCCACGACGTCGAC
GCGGCCGAGGAAGGCGGCGCGCCGCCAGCCGATGCAGCCCTCAGCTTTACCAACATCAATTTCGATCCCGACCCG
CAGCTCGACGCCAGGGCCAACCAAGACCCCGACATCCCCGCGCCCGCCGAGACGGTCGAGGACCTGTTGAAGGCG
GCGTGGCCAGCCTTCAGGAGGGGCCGGATCCTCACCTGGAGCGAGCTGCTGCCGCCCAAGAAGGCCGTGTGGAAG
GAGAAGAAGCCGCTGAAGAAGCCCAAGCGTCTCGTGACGAGCAAGCTGACCCTCGAGCTGGCCCCCGACCAGGAG
AAACAGTTCCGCATCCCTGGGACGGCCGCCCCGACCAAACGCCGATCGCAGAATCTTCTCGCCGGTCTCGTCCGC
TGCGACGAGGACGCCGCCTCCCAAGACGGTAGTTCCGATAGGATCGACCTCGACCAAGAATCCGACTCGGAAACG
GTCTGCGGCTTCACGCTGCGCGACATAGAGATGGCTTGCGAGGACTGGGGCGCTCGCATCGAGGCCGTCGAGGAC
GAGTTCCTGGCCATCCAGGCCCGAGAAAAGAGGGAGGAGGAGCTCGCGCGCAGGCGCCACCGGCCCGACGACGAC
GAGGACGACGAGCAGGACGCCGAATGGGACGCCGAGTTTCTGCAGGACGCGACGGACGAGGACCATGCTCAGCCG
CGGCCCAAGAAGCGCAGGGCCATCCGGTTCGGCCTTCCGGAAATCCCACGGTACACGGCGCCGTCCTTTGACAAC
TTCGAGGAGATGACCCGCCAAGGCGCCAAGCGCGTCCAGCTCGACATGTCCGACCCCTACCTCCTGCTCGAGATG
GAGTCGTCGCAGCATCCGGCGAAGCGCCCCCGGCTCGAGGCCCAGTCCAAGCGCCTGCCCAACGGCAAGATCAGC
CGCGATCTGACGCAGCGATACAATCTCTCCAACGACGAGTCGTACGAGCTCCTCAAGGAGAACCACCAGAGCAAG
GTCCGGGCCACGCTCGGCAACATCTCGGTCGAGCACAGCATGCCGGCCATCAAGCTCACCTGGCCCTACTACAAG
GTCAAGCTCGCCGGCACGACGGACGAGTACCACCGACCGCGTTTCCGCTACAAGAAGTTCGTCGGCCACGTCATT
AAGTTCGACAAGCCCCATCACCACAAGCGCAAGCAGATGAAGGGCAAGGCCCACGAGGTGTTCATGCACTCCAAG
GACCTCAGCATGGCCGACAACTCGACGGCCGTGCTCTTCGAGTACTGCGAGCCCCGGCCGCGGGTGCTCAACAAC
TTTGGCATGGGCAACAAGCTCATTAACTACCACCGCCGCAAGGACAACAAGGACGAGGAGCAGCTCCCGAAGCAG
GACCTCGGCGAATACCGCATGCTCCTGCCGGAGGACCGCTCTCCCTTCTCGCTCTTCGGCACCGTCGACGTGGGC
GAGACGGTGCCGACGCTGCACAACGAGATGTACCGGGCCCCGGTCTTCAAGCACAGCCCCCGGGCCACCGACTTC
CTCGTCGTCCGCAGCACGACGGGCATCGAGGGCTCGCGCTGGTACCTGCACAAGATCGACCACCTCCACGTCGTC
GGGCAGACGTTCCCCTCGGTCGACGTGCCGGGCCCGCACAGTCGCAAGGTGACGAACGCGTCCAAGAGCAGGATG
AAGATGCTCGCCTTCCGCATGATCCGCCACAGCCAGTCGGACAACTGCCAGCTCTCGGACATCACCAAGCACATC
GCGGAGTCGACGGACACGCAGAACCGCCAGAAGCTCAAGGAATTCCTGCAGTACGACCGGGACAGCAACGAAAAG
GGCATGTGGCGTCTCAAGCCCGGGGAGATCTTGCCCGACGAGAACGCGATCCGGGCCATGATCAAGCCGGAGGAG
GTCAGCCTGCTGGACGCCATGCAGCTCGGCATCAAGGAGTTGGAGGACGCCGGGTACGATCCCCGGAACGCGAAC
ATCGAGGACGAACAGATGGCCGACGCCGACGGGGACGAGGAAGACGCGGCCGTGGACGACGACGGGAGCAAGATC
GCAAAGGGGCCCAAAAAGGCGGCGGAGAAGCAGGAGGAGACGCTGGCGGACAAGATGGCGCCGTGGAAGACGACC
AAGGCCTTCATCGACGCATGTGCCCAGAAGGCCATGCTGCAGCTGCACGGCGAGGGCGACCCGACGGGCCACGGC
CTCGGCTTCAGCTTCATCCGGACGTCGATGAAGGGCGGCTACATCGAGGCCGTCCAGGGCCCGCTGGCGACATCG
GCCGACGCCATGGAGCGGGAGAAGCGCGCCAACGGCGGGCACGCGTACAACGTCAAGAAGCAGCAGGCCATGTAC
GAGGAGGGGATCCGCGAGATATGGGAGAAGCAGAGGGCGACGCTTTCGGACCCACAGGAGCACGACGACAAGGAC
GTGGCCGTGACCGAGGACGAAGACGACCGGTTCAACGTCAACAACGCGTCGGCGGCGGCGGCGGCGGCGGTGGCG
GCGGCGGCGACGCCGGCACTGTTCGACGAGGGCGTCAGCCAGATCAGCGGGCTAACGTCGTCGAGCCGGCACCAG
AAGCGGGCGATCCGCATCACGAGGGAAGTGCAGATGCCGGACGGCACGAGGCAGGCCCGGATCGAAGTCGTCCAC
GACCCCGTCGTCATCTCGCAGTATATGAAGCGGCGCACCGAGGCGGATCTGGAGCTTCGAGAGTACGTCTCCTCC
TCTCTCCGCCCCCCCAGCCGTGCCCGGCCCCCTGCACCAGCCCGGACCCGGAACCGGCCGCCGTCCTTGGTCGGA
ACCCTGCACAGACGGGCACGTGCCGCGAGCGTCCAGGGCCGAGTGGACCGTCGGCGCGGCGGCTTCGTTGCGCCC
GGCTCGGTGGCAGACGGGATCGGCCAAGAATGGAGGGCCCCTGCTTACGTCTATCTCTCCACAGCATATACAGCT
CCCGGCCTACGGGCAATGCCGACCATGACCGTCTTGCAAATCTTAGGTAAGGCCCCCCTCGTCCCGGGATCTGCG
CTCGGCGTCGGCAGAGGACAAGACTAACGCCAAGGGCGCTCCAGGATCAAGAAGGAACTCGAGCGACTGGAGAAG
AACAAGGCCAGACGACAAGCGCGAGAACAGCAGAAAGAGTTGCACCAGAAGGCCAACGCCGGCGACGCCGGATCC
CCCGGCCCCAACGGCGCTGACAAGGTGCCGACAGGAACGACCCGCAAGTGTGCCAATTGTGGACAGGTCGGGCAC
ATCAAAACGAATAAGAAGTATGCAATGCCCAGTCCCCCCCCCTCCCCGGCCCCCCTTCGATTGGTGGGGTGCACT
GGAGGCGCCGGATGAAGCCGGAGACGGGAAGAGCGGCGGCGGCAGGCGGAAGAGGACGAAGAGGAGGGAGAAGAA
AGCTCTTCTCCCACAACTGCTGCGGAAGGCCGACAAGCAGAAGCAAAAAGAATCGAAGAAGCAGCTGGCGCGCGA
CAAGGCCGCAGCCAAGGTGGCGCAGAGGGCGGCGCAGAGGGCGGCGCGGGATGCCGAGAGGGCGAGTGCCCGCCG
GGCGCGACAGGAGAGGATGCGGAAGTTGCGCGAGGAGCGCGAGGCGGAGAGGAGAGGGAGAGAGGAGGAACGACA
GAGGGCGCAACGGCAGTACCGAGCGCAGCGGGAGCGCATCTCGCGCGAGATGGAAGAGCGGCGTCGGAGAGCGCG
AGAGGAGCGGGAAGAGCGGCGCCAGAGAGCGCGAGAAGAAAGGGAAGAGCGGCGGCGCAGGGCAGAGCGGAAGCG
GCTCGAGCCTCGGCCGGGACACGTGCAGAGGCTGAAGAACGGACCCAAGCGGCCCCGGTTCGCCAGCTCTGGATG
GGCGGGACAGTGAGGGCACAGTGCACGCCACCAAGCGGAGGGGGGGGAAGGGGAACAAGAGGTCGTGATTTTGCG
AAGAGTGAGGCGGACATGTGTGCTAACGCGTCGGATCTCTCGCAGGTTATGTCCTCTGCTCAACGGCACGATGAA
GGCGGACCAGGGCGCGGCGGAGCACGGCGGCTTTGGTAACTACAACGCCCCGGCCGGCGGCGCGGGCTCGCCAGG
CGCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail