Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8925
Gene name
LocationContig_613:6073..8331
Strand-
Gene length (bp)2258
Transcript length (bp)2187
Coding sequence length (bp)2187
Protein length (aa) 729

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07727 RVT_2 Reverse transcriptase (RNA-dependent DNA polymerase) 4.5E-36 344 561

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 5 648 4.0E-56
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 1 645 5.0E-32
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 409 662 2.0E-26
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 266 646 5.0E-26
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 266 646 9.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 5 648 4.0E-56
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 1 645 5.0E-32
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 409 662 2.0E-26
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 266 646 5.0E-26
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 266 646 9.0E-26
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 353 639 3.0E-17
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 353 639 4.0E-17
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 353 639 5.0E-17
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 353 639 6.0E-17
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 353 639 6.0E-17
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 353 639 6.0E-17
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 353 639 7.0E-17
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 353 639 8.0E-17
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 353 639 1.0E-16
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 353 639 1.0E-16
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 353 639 1.0E-16
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 353 639 2.0E-16
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 353 639 2.0E-16
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 353 639 2.0E-16
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 353 639 2.0E-16
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 353 639 2.0E-16
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 353 639 2.0E-16
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 353 639 2.0E-16
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 353 639 3.0E-16
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 353 639 3.0E-16
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 353 639 3.0E-16
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 353 639 4.0E-16
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 353 639 4.0E-16
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 353 639 4.0E-16
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 353 639 4.0E-16
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 353 639 4.0E-16
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 353 639 4.0E-16
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 353 639 5.0E-16
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 353 639 5.0E-16
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 353 639 5.0E-16
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 353 639 7.0E-16
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 353 639 1.0E-15
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 353 639 1.0E-15
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 353 639 2.0E-15
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 353 639 2.0E-15
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 353 639 2.0E-15
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 353 639 2.0E-15
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 353 639 2.0E-15
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 353 639 2.0E-15
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 353 639 2.0E-15
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 353 639 2.0E-15
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 353 639 2.0E-15
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 353 639 2.0E-15
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 353 639 3.0E-15
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 353 551 8.0E-12
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8925
MRIGANLPEELWPEVWKTAVYLHNRSPQQVNNWKTPFQRLHQWLQDSNHDSGYLHTQPDITHLKTYGCRAYPMTP
AALVGKQKKDLKTQPHAEVGYLVGYDSTNIFRIWIPEKHEVRRVRDVTFDETVLYDPKDHQQRLHIETLEPHVKL
PVHIDSGSELEEHERIRPGTHVEPESQSEQEIESEDEAQSTIWVGGQLKEDNADQQLDEPGSQDSERQDDENQSS
QQDDYNGKQKDASPAGTTQHEIHNRLQAEAKDHSVEQKAKKNVKRSDHELDQPKRKSTRERMPSAKAREAASGSP
KKLHELNGHRFEPEFRKAMETEWTNVNRRGTVQPISRDQVAGQILPLTWVFKYKFNKQRYLQKFKARICVRGDLQ
PPDSRDTYAATLAGRSFQILMAITAKFDLETRQLDAVNAFTNSLLDEDVYVQFPDGYRRKGWVLKLLRALYGLRR
SPLLWQKDLTAAFEKLGLKQSQEEPCLFTDNWLTVFFFVDDIVLLHRTKHRKAADEFIAKLKAQYEMNDLGELKW
FLGIRVLRDRTARKLWLCQDSYIEKIANQYRITQRDQFKGNLFPTNDLQPRGDQASPDLVHRYQQKVGSINYVAV
ITRPDIAKATAKLAEFLQNPSERHNQLVDRVMEYLWSSRFLAMQFNGTSSGTDLIKINYGSAPRDLRIASDAAWS
HPRKLLPAWAPSLPSTYRSQPSDSRSSAGLDPSTARRLRLTSKFPKSREAIMR*
Coding >Hirsu2|8925
ATGAGAATCGGCGCCAATCTCCCCGAGGAACTATGGCCCGAAGTCTGGAAGACTGCGGTCTATCTGCACAACAGA
TCGCCCCAGCAGGTCAACAACTGGAAAACGCCCTTCCAACGGCTGCACCAGTGGCTACAAGATAGCAATCATGAT
AGTGGATATCTCCACACGCAACCGGATATCACTCACCTCAAAACCTACGGATGTCGCGCATATCCAATGACGCCG
GCAGCGCTTGTCGGAAAACAGAAGAAGGACCTCAAGACCCAGCCACACGCAGAAGTCGGATACCTTGTCGGGTAC
GACTCAACCAACATCTTCAGAATATGGATTCCGGAGAAACACGAGGTTCGTCGAGTGCGAGACGTGACATTTGAC
GAAACCGTTCTCTACGATCCCAAGGATCACCAGCAAAGGCTCCATATCGAAACCCTGGAACCGCATGTCAAACTC
CCTGTCCACATCGACAGTGGCTCAGAGCTCGAAGAGCATGAAAGAATCAGGCCAGGAACACATGTCGAGCCGGAA
TCACAATCTGAGCAAGAGATAGAGAGTGAAGACGAAGCCCAGTCAACCATATGGGTCGGTGGTCAACTCAAGGAA
GACAATGCAGATCAGCAGCTTGACGAGCCAGGCTCGCAAGACTCAGAGCGTCAAGACGACGAGAACCAATCTAGC
CAGCAAGATGACTACAATGGTAAACAGAAAGATGCTTCGCCTGCTGGAACGACACAGCATGAGATCCACAACCGG
CTTCAGGCAGAAGCAAAGGATCACAGTGTAGAGCAGAAAGCGAAGAAGAATGTAAAGAGGTCAGACCACGAACTC
GACCAACCCAAACGCAAATCGACACGTGAGAGAATGCCAAGCGCAAAAGCTCGAGAAGCAGCAAGTGGCTCCCCC
AAGAAACTCCATGAGCTTAATGGCCATCGATTCGAGCCAGAATTTAGAAAAGCCATGGAAACGGAATGGACGAAC
GTGAACAGACGAGGAACGGTTCAGCCAATCTCAAGGGATCAGGTAGCTGGTCAGATCCTGCCACTAACCTGGGTG
TTCAAATACAAGTTCAACAAACAGAGATACCTTCAGAAGTTCAAAGCACGGATCTGCGTTCGAGGCGATCTTCAG
CCGCCAGACTCCAGGGACACGTACGCAGCCACTCTTGCGGGACGCTCCTTTCAGATTTTAATGGCCATCACTGCC
AAGTTCGACCTCGAGACACGTCAGCTCGACGCAGTCAACGCGTTCACAAATAGCCTCCTTGATGAAGACGTCTAT
GTCCAATTCCCAGACGGCTATCGTCGCAAAGGATGGGTCCTAAAACTGCTACGAGCACTATACGGATTAAGAAGG
TCGCCTCTGCTATGGCAGAAAGACCTAACCGCGGCTTTCGAAAAGCTCGGTCTCAAGCAAAGCCAGGAGGAACCA
TGTCTCTTCACTGATAATTGGCTCACTGTTTTCTTCTTTGTAGACGACATCGTTCTGCTACATCGCACCAAGCAT
CGGAAAGCAGCAGACGAATTCATCGCCAAACTCAAAGCCCAATACGAAATGAATGACCTGGGGGAACTCAAGTGG
TTCCTAGGCATCCGAGTCTTACGAGACAGAACAGCACGCAAGCTGTGGCTCTGCCAAGACTCATACATTGAGAAA
ATTGCAAATCAATACAGAATCACCCAACGTGATCAATTCAAGGGAAACCTGTTCCCTACCAACGACCTACAGCCC
CGTGGGGACCAGGCCAGTCCAGACCTCGTCCACCGGTATCAACAAAAGGTCGGCTCCATCAACTACGTCGCAGTC
ATCACTCGACCCGACATTGCCAAGGCAACAGCCAAGCTGGCAGAATTCCTACAGAATCCATCAGAACGACACAAC
CAGTTGGTGGATCGCGTAATGGAATACCTCTGGTCAAGCCGATTTCTGGCCATGCAGTTCAATGGAACAAGTAGC
GGCACAGACTTGATCAAGATCAATTACGGCAGTGCTCCACGAGACCTACGCATCGCATCAGACGCCGCCTGGAGC
CACCCACGGAAACTCCTCCCTGCCTGGGCGCCCTCCTTGCCTTCTACGTACCGATCACAGCCCTCTGATAGCCGA
AGCAGCGCCGGATTAGATCCGTCGACGGCACGGCGATTGCGCTTGACCAGCAAATTTCCGAAATCGAGAGAAGCC
ATCATGCGTTAA
Transcript >Hirsu2|8925
ATGAGAATCGGCGCCAATCTCCCCGAGGAACTATGGCCCGAAGTCTGGAAGACTGCGGTCTATCTGCACAACAGA
TCGCCCCAGCAGGTCAACAACTGGAAAACGCCCTTCCAACGGCTGCACCAGTGGCTACAAGATAGCAATCATGAT
AGTGGATATCTCCACACGCAACCGGATATCACTCACCTCAAAACCTACGGATGTCGCGCATATCCAATGACGCCG
GCAGCGCTTGTCGGAAAACAGAAGAAGGACCTCAAGACCCAGCCACACGCAGAAGTCGGATACCTTGTCGGGTAC
GACTCAACCAACATCTTCAGAATATGGATTCCGGAGAAACACGAGGTTCGTCGAGTGCGAGACGTGACATTTGAC
GAAACCGTTCTCTACGATCCCAAGGATCACCAGCAAAGGCTCCATATCGAAACCCTGGAACCGCATGTCAAACTC
CCTGTCCACATCGACAGTGGCTCAGAGCTCGAAGAGCATGAAAGAATCAGGCCAGGAACACATGTCGAGCCGGAA
TCACAATCTGAGCAAGAGATAGAGAGTGAAGACGAAGCCCAGTCAACCATATGGGTCGGTGGTCAACTCAAGGAA
GACAATGCAGATCAGCAGCTTGACGAGCCAGGCTCGCAAGACTCAGAGCGTCAAGACGACGAGAACCAATCTAGC
CAGCAAGATGACTACAATGGTAAACAGAAAGATGCTTCGCCTGCTGGAACGACACAGCATGAGATCCACAACCGG
CTTCAGGCAGAAGCAAAGGATCACAGTGTAGAGCAGAAAGCGAAGAAGAATGTAAAGAGGTCAGACCACGAACTC
GACCAACCCAAACGCAAATCGACACGTGAGAGAATGCCAAGCGCAAAAGCTCGAGAAGCAGCAAGTGGCTCCCCC
AAGAAACTCCATGAGCTTAATGGCCATCGATTCGAGCCAGAATTTAGAAAAGCCATGGAAACGGAATGGACGAAC
GTGAACAGACGAGGAACGGTTCAGCCAATCTCAAGGGATCAGGTAGCTGGTCAGATCCTGCCACTAACCTGGGTG
TTCAAATACAAGTTCAACAAACAGAGATACCTTCAGAAGTTCAAAGCACGGATCTGCGTTCGAGGCGATCTTCAG
CCGCCAGACTCCAGGGACACGTACGCAGCCACTCTTGCGGGACGCTCCTTTCAGATTTTAATGGCCATCACTGCC
AAGTTCGACCTCGAGACACGTCAGCTCGACGCAGTCAACGCGTTCACAAATAGCCTCCTTGATGAAGACGTCTAT
GTCCAATTCCCAGACGGCTATCGTCGCAAAGGATGGGTCCTAAAACTGCTACGAGCACTATACGGATTAAGAAGG
TCGCCTCTGCTATGGCAGAAAGACCTAACCGCGGCTTTCGAAAAGCTCGGTCTCAAGCAAAGCCAGGAGGAACCA
TGTCTCTTCACTGATAATTGGCTCACTGTTTTCTTCTTTGTAGACGACATCGTTCTGCTACATCGCACCAAGCAT
CGGAAAGCAGCAGACGAATTCATCGCCAAACTCAAAGCCCAATACGAAATGAATGACCTGGGGGAACTCAAGTGG
TTCCTAGGCATCCGAGTCTTACGAGACAGAACAGCACGCAAGCTGTGGCTCTGCCAAGACTCATACATTGAGAAA
ATTGCAAATCAATACAGAATCACCCAACGTGATCAATTCAAGGGAAACCTGTTCCCTACCAACGACCTACAGCCC
CGTGGGGACCAGGCCAGTCCAGACCTCGTCCACCGGTATCAACAAAAGGTCGGCTCCATCAACTACGTCGCAGTC
ATCACTCGACCCGACATTGCCAAGGCAACAGCCAAGCTGGCAGAATTCCTACAGAATCCATCAGAACGACACAAC
CAGTTGGTGGATCGCGTAATGGAATACCTCTGGTCAAGCCGATTTCTGGCCATGCAGTTCAATGGAACAAGTAGC
GGCACAGACTTGATCAAGATCAATTACGGCAGTGCTCCACGAGACCTACGCATCGCATCAGACGCCGCCTGGAGC
CACCCACGGAAACTCCTCCCTGCCTGGGCGCCCTCCTTGCCTTCTACGTACCGATCACAGCCCTCTGATAGCCGA
AGCAGCGCCGGATTAGATCCGTCGACGGCACGGCGATTGCGCTTGACCAGCAAATTTCCGAAATCGAGAGAAGCC
ATCATGCGTTAA
Gene >Hirsu2|8925
ATGAGAATCGGCGCCAATCTCCCCGAGGAACTATGGCCCGAAGTCTGGAAGACTGCGGTCTATCTGCACAACAGA
TCGCCCCAGCAGGTCAACAACTGGAAAACGCCCTTCCAACGGCTGCACCAGTGGCTACAAGATAGCAATCATGAT
AGTGGATATCTCCACACGCAACCGGATATCACTCACCTCAAAACCTACGGATGTCGCGCATATCCAATGACGCCG
GCAGCGCTTGTCGGAAAACAGAAGAAGGACCTCAAGACCCAGCCACACGCAGAAGTCGGATACCTTGTCGGGTAC
GACTCAACCAACATCTTCAGAATATGGATTCCGGAGAAACACGAGGTTCGTCGAGTGCGAGACGTGACATTTGAC
GAAACCGTTCTCTACGATCCCAAGGATCACCAGCAAAGGCTCCATATCGAAACCCTGGAACCGCATGTCAAACTC
CCTGTCCACATCGACAGTGGCTCAGAGCTCGAAGAGCATGAAAGAATCAGGCCAGGAACACATGTCGAGCCGGAA
TCACAATCTGAGCAAGAGATAGAGAGTGAAGACGAAGCCCAGTCAACCATATGGGTCGGTGGTCAACTCAAGGAA
GACAATGCAGATCAGCAGCTTGACGAGCCAGGCTCGCAAGACTCAGAGCGTCAAGACGACGAGAACCAATCTAGC
CAGCAAGATGACTACAATGGTAAACAGAAAGATGCTTCGCCTGCTGGAACGACACAGCATGAGATCCACAACCGG
CTTCAGGCAGAAGCAAAGGATCACAGTGTAGAGCAGAAAGCGAAGAAGAATGTAAAGAGGTCAGACCACGAACTC
GACCAACCCAAACGCAAATCGACACGTGAGAGAATGCCAAGCGCAAAAGCTCGAGAAGCAGCAAGTGGCTCCCGT
GCGATTTACCGAAGCAGCTTCTTCATCGGTCCCGAGCAAATGATGCACCGAAGAGGCCTTCCTTCAGAGCCAAGA
AACTCCATGAGCTTAATGGCCATCGATTCGAGCCAGAATTTAGAAAAGCCATGGAAACGGAATGGACGAACGTGA
ACAGACGAGGAACGGTTCAGCCAATCTCAAGGGATCAGGTAGCTGGTCAGATCCTGCCACTAACCTGGGTGTTCA
AATACAAGTTCAACAAACAGAGATACCTTCAGAAGTTCAAAGCACGGATCTGCGTTCGAGGCGATCTTCAGCCGC
CAGACTCCAGGGACACGTACGCAGCCACTCTTGCGGGACGCTCCTTTCAGATTTTAATGGCCATCACTGCCAAGT
TCGACCTCGAGACACGTCAGCTCGACGCAGTCAACGCGTTCACAAATAGCCTCCTTGATGAAGACGTCTATGTCC
AATTCCCAGACGGCTATCGTCGCAAAGGATGGGTCCTAAAACTGCTACGAGCACTATACGGATTAAGAAGGTCGC
CTCTGCTATGGCAGAAAGACCTAACCGCGGCTTTCGAAAAGCTCGGTCTCAAGCAAAGCCAGGAGGAACCATGTC
TCTTCACTGATAATTGGCTCACTGTTTTCTTCTTTGTAGACGACATCGTTCTGCTACATCGCACCAAGCATCGGA
AAGCAGCAGACGAATTCATCGCCAAACTCAAAGCCCAATACGAAATGAATGACCTGGGGGAACTCAAGTGGTTCC
TAGGCATCCGAGTCTTACGAGACAGAACAGCACGCAAGCTGTGGCTCTGCCAAGACTCATACATTGAGAAAATTG
CAAATCAATACAGAATCACCCAACGTGATCAATTCAAGGGAAACCTGTTCCCTACCAACGACCTACAGCCCCGTG
GGGACCAGGCCAGTCCAGACCTCGTCCACCGGTATCAACAAAAGGTCGGCTCCATCAACTACGTCGCAGTCATCA
CTCGACCCGACATTGCCAAGGCAACAGCCAAGCTGGCAGAATTCCTACAGAATCCATCAGAACGACACAACCAGT
TGGTGGATCGCGTAATGGAATACCTCTGGTCAAGCCGATTTCTGGCCATGCAGTTCAATGGAACAAGTAGCGGCA
CAGACTTGATCAAGATCAATTACGGCAGTGCTCCACGAGACCTACGCATCGCATCAGACGCCGCCTGGAGCCACC
CACGGAAACTCCTCCCTGCCTGGGCGCCCTCCTTGCCTTCTACGTACCGATCACAGCCCTCTGATAGCCGAAGCA
GCGCCGGATTAGATCCGTCGACGGCACGGCGATTGCGCTTGACCAGCAAATTTCCGAAATCGAGAGAAGCCATCA
TGCGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail