Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8924
Gene name
LocationContig_613:4699..6037
Strand+
Gene length (bp)1338
Transcript length (bp)1338
Coding sequence length (bp)1338
Protein length (aa) 446

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17667 Pkinase_fungal Fungal protein kinase 1.0E-91 1 337

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1744 0.9338 0.5895 0.0268 0.0598 0.0027 0.0254 0.0074 0.0052 0.0105

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup58
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4910
Ophiocordyceps camponoti-floridani Ophcf2|06958
Ophiocordyceps camponoti-rufipedis Ophun1|4560
Ophiocordyceps camponoti-rufipedis Ophun1|3608
Ophiocordyceps camponoti-rufipedis Ophun1|3607
Ophiocordyceps camponoti-rufipedis Ophun1|3606
Ophiocordyceps camponoti-rufipedis Ophun1|1918
Ophiocordyceps camponoti-rufipedis Ophun1|4301
Ophiocordyceps kimflemingae Ophio5|7704
Ophiocordyceps subramaniannii Hirsu2|299
Ophiocordyceps subramaniannii Hirsu2|8307
Ophiocordyceps subramaniannii Hirsu2|8186
Ophiocordyceps subramaniannii Hirsu2|7741
Ophiocordyceps subramaniannii Hirsu2|7709
Ophiocordyceps subramaniannii Hirsu2|5174
Ophiocordyceps subramaniannii Hirsu2|4474
Ophiocordyceps subramaniannii Hirsu2|3083
Ophiocordyceps subramaniannii Hirsu2|86
Ophiocordyceps subramaniannii Hirsu2|8924 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8924
MMNDEELGLDTFTERNGDGPMIQIEQDGTPGRKRLHLESQPFTCQRAIVCRGTACYLTKPPNSEDWSYVAKFSCT
PDRRKPEADLLRLAGQKGVEGIAELIGHRRITSINEMRSSLTFTNLYSFRGLPKTASTFSHSFSRSHLPRTPSHS
FSELPGLSIADKPSRKRQSVDVCQKSSKRSRSNSQKSSQRQNEVAYDVEEAQGTSLLASNNGPCDNRVFRRLVIS
PAGRAIHKYEKISELLEALRDAIRAHRSLCPKGNILHRDISENNIIITDRKATGHMSMLIDLDLAKALGSGRSGA
RCRTGTMKFMAIEVLQGISHTYRHDLESFFYVLLWLCGRRGWEFLRSQKEQPTPSLLTKWYSGSYREIAGAKRGY
MHVDKFEDILEEFPQPGFDCVKPLCRELRGILFPYRDGLFIGTPKDPEILYGPIINAFEKAIDGIKTMER*
Coding >Hirsu2|8924
ATGATGAATGATGAAGAACTGGGCTTGGACACATTTACAGAACGGAATGGCGACGGTCCCATGATACAGATTGAG
CAGGACGGGACCCCAGGCAGGAAGAGGCTGCACTTGGAGTCGCAGCCTTTCACCTGTCAACGGGCAATTGTCTGC
CGTGGGACGGCTTGCTATCTCACGAAGCCTCCGAACTCTGAAGACTGGAGTTATGTGGCCAAGTTTTCGTGCACA
CCCGACAGGCGAAAGCCAGAGGCAGACCTTCTCAGATTAGCCGGTCAGAAAGGAGTCGAGGGCATTGCAGAGTTG
ATCGGCCACCGTCGCATAACCAGTATCAATGAGATGCGATCAAGCCTGACATTTACGAACCTTTACTCCTTCCGA
GGCCTTCCAAAAACTGCGTCGACTTTTTCGCATTCTTTCTCCCGATCCCATCTTCCCAGAACCCCTTCTCACTCC
TTCAGCGAGCTTCCTGGTTTAAGCATCGCTGATAAGCCGTCAAGAAAGCGCCAATCGGTTGATGTCTGCCAGAAA
TCGTCTAAGCGATCAAGATCCAACAGTCAAAAGTCGAGCCAAAGGCAAAACGAGGTTGCGTACGATGTGGAGGAA
GCCCAAGGGACGAGTCTGCTCGCTTCCAATAACGGACCTTGTGACAATCGAGTTTTCCGACGTCTAGTTATCTCT
CCAGCAGGCCGAGCGATCCACAAGTACGAAAAGATATCGGAGCTCCTGGAGGCGCTCCGCGACGCCATCAGGGCA
CACAGGTCCCTATGCCCAAAAGGCAACATCCTGCACCGGGACATTTCCGAGAACAACATCATCATAACAGACCGC
AAGGCGACTGGGCACATGAGCATGCTGATCGACCTGGACCTTGCCAAGGCGCTTGGCAGTGGGCGCAGCGGTGCA
CGCTGTCGCACTGGCACGATGAAGTTCATGGCAATTGAGGTTCTGCAAGGGATCTCTCACACCTACCGGCATGAT
CTGGAGTCGTTCTTCTATGTGCTCCTCTGGCTGTGTGGTCGTCGTGGCTGGGAATTTCTGCGCAGCCAGAAGGAG
CAGCCTACACCAAGTCTGTTGACTAAGTGGTACTCCGGCAGCTATCGAGAGATTGCGGGCGCCAAACGAGGGTAT
ATGCACGTTGATAAATTTGAAGATATCCTTGAGGAGTTCCCGCAACCAGGGTTCGACTGTGTCAAGCCTCTTTGC
AGAGAGTTGCGGGGGATTTTGTTTCCTTACAGGGATGGACTTTTCATCGGGACACCAAAGGATCCTGAGATTCTT
TATGGGCCAATCATCAATGCATTTGAAAAGGCTATTGATGGAATTAAGACCATGGAAAGATAA
Transcript >Hirsu2|8924
ATGATGAATGATGAAGAACTGGGCTTGGACACATTTACAGAACGGAATGGCGACGGTCCCATGATACAGATTGAG
CAGGACGGGACCCCAGGCAGGAAGAGGCTGCACTTGGAGTCGCAGCCTTTCACCTGTCAACGGGCAATTGTCTGC
CGTGGGACGGCTTGCTATCTCACGAAGCCTCCGAACTCTGAAGACTGGAGTTATGTGGCCAAGTTTTCGTGCACA
CCCGACAGGCGAAAGCCAGAGGCAGACCTTCTCAGATTAGCCGGTCAGAAAGGAGTCGAGGGCATTGCAGAGTTG
ATCGGCCACCGTCGCATAACCAGTATCAATGAGATGCGATCAAGCCTGACATTTACGAACCTTTACTCCTTCCGA
GGCCTTCCAAAAACTGCGTCGACTTTTTCGCATTCTTTCTCCCGATCCCATCTTCCCAGAACCCCTTCTCACTCC
TTCAGCGAGCTTCCTGGTTTAAGCATCGCTGATAAGCCGTCAAGAAAGCGCCAATCGGTTGATGTCTGCCAGAAA
TCGTCTAAGCGATCAAGATCCAACAGTCAAAAGTCGAGCCAAAGGCAAAACGAGGTTGCGTACGATGTGGAGGAA
GCCCAAGGGACGAGTCTGCTCGCTTCCAATAACGGACCTTGTGACAATCGAGTTTTCCGACGTCTAGTTATCTCT
CCAGCAGGCCGAGCGATCCACAAGTACGAAAAGATATCGGAGCTCCTGGAGGCGCTCCGCGACGCCATCAGGGCA
CACAGGTCCCTATGCCCAAAAGGCAACATCCTGCACCGGGACATTTCCGAGAACAACATCATCATAACAGACCGC
AAGGCGACTGGGCACATGAGCATGCTGATCGACCTGGACCTTGCCAAGGCGCTTGGCAGTGGGCGCAGCGGTGCA
CGCTGTCGCACTGGCACGATGAAGTTCATGGCAATTGAGGTTCTGCAAGGGATCTCTCACACCTACCGGCATGAT
CTGGAGTCGTTCTTCTATGTGCTCCTCTGGCTGTGTGGTCGTCGTGGCTGGGAATTTCTGCGCAGCCAGAAGGAG
CAGCCTACACCAAGTCTGTTGACTAAGTGGTACTCCGGCAGCTATCGAGAGATTGCGGGCGCCAAACGAGGGTAT
ATGCACGTTGATAAATTTGAAGATATCCTTGAGGAGTTCCCGCAACCAGGGTTCGACTGTGTCAAGCCTCTTTGC
AGAGAGTTGCGGGGGATTTTGTTTCCTTACAGGGATGGACTTTTCATCGGGACACCAAAGGATCCTGAGATTCTT
TATGGGCCAATCATCAATGCATTTGAAAAGGCTATTGATGGAATTAAGACCATGGAAAGATAA
Gene >Hirsu2|8924
ATGATGAATGATGAAGAACTGGGCTTGGACACATTTACAGAACGGAATGGCGACGGTCCCATGATACAGATTGAG
CAGGACGGGACCCCAGGCAGGAAGAGGCTGCACTTGGAGTCGCAGCCTTTCACCTGTCAACGGGCAATTGTCTGC
CGTGGGACGGCTTGCTATCTCACGAAGCCTCCGAACTCTGAAGACTGGAGTTATGTGGCCAAGTTTTCGTGCACA
CCCGACAGGCGAAAGCCAGAGGCAGACCTTCTCAGATTAGCCGGTCAGAAAGGAGTCGAGGGCATTGCAGAGTTG
ATCGGCCACCGTCGCATAACCAGTATCAATGAGATGCGATCAAGCCTGACATTTACGAACCTTTACTCCTTCCGA
GGCCTTCCAAAAACTGCGTCGACTTTTTCGCATTCTTTCTCCCGATCCCATCTTCCCAGAACCCCTTCTCACTCC
TTCAGCGAGCTTCCTGGTTTAAGCATCGCTGATAAGCCGTCAAGAAAGCGCCAATCGGTTGATGTCTGCCAGAAA
TCGTCTAAGCGATCAAGATCCAACAGTCAAAAGTCGAGCCAAAGGCAAAACGAGGTTGCGTACGATGTGGAGGAA
GCCCAAGGGACGAGTCTGCTCGCTTCCAATAACGGACCTTGTGACAATCGAGTTTTCCGACGTCTAGTTATCTCT
CCAGCAGGCCGAGCGATCCACAAGTACGAAAAGATATCGGAGCTCCTGGAGGCGCTCCGCGACGCCATCAGGGCA
CACAGGTCCCTATGCCCAAAAGGCAACATCCTGCACCGGGACATTTCCGAGAACAACATCATCATAACAGACCGC
AAGGCGACTGGGCACATGAGCATGCTGATCGACCTGGACCTTGCCAAGGCGCTTGGCAGTGGGCGCAGCGGTGCA
CGCTGTCGCACTGGCACGATGAAGTTCATGGCAATTGAGGTTCTGCAAGGGATCTCTCACACCTACCGGCATGAT
CTGGAGTCGTTCTTCTATGTGCTCCTCTGGCTGTGTGGTCGTCGTGGCTGGGAATTTCTGCGCAGCCAGAAGGAG
CAGCCTACACCAAGTCTGTTGACTAAGTGGTACTCCGGCAGCTATCGAGAGATTGCGGGCGCCAAACGAGGGTAT
ATGCACGTTGATAAATTTGAAGATATCCTTGAGGAGTTCCCGCAACCAGGGTTCGACTGTGTCAAGCCTCTTTGC
AGAGAGTTGCGGGGGATTTTGTTTCCTTACAGGGATGGACTTTTCATCGGGACACCAAAGGATCCTGAGATTCTT
TATGGGCCAATCATCAATGCATTTGAAAAGGCTATTGATGGAATTAAGACCATGGAAAGATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail