Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|891
Gene name
LocationContig_1188:66..2984
Strand-
Gene length (bp)2918
Transcript length (bp)2664
Coding sequence length (bp)2664
Protein length (aa) 888

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05833 FbpA Fibronectin-binding protein A N-terminus (FbpA) 3.2E-31 7 524
PF05670 NFACT-R_1 NFACT protein RNA binding domain 1.6E-29 548 661

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USN8|RQC2_SCHPO Ribosome quality control complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mtr1 PE=1 SV=2 1 694 1.0E-164
sp|Q8CCP0|NEMF_MOUSE Nuclear export mediator factor Nemf OS=Mus musculus GN=Nemf PE=1 SV=2 1 755 8.0E-138
sp|Q12532|RQC2_YEAST Ribosome quality control complex subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RQC2 PE=1 SV=1 1 681 1.0E-120
sp|Q9VBX1|NEMF_DROME Nuclear export mediator factor NEMF homolog OS=Drosophila melanogaster GN=Clbn PE=1 SV=2 1 712 2.0E-112
sp|Q59020|Y1625_METJA Uncharacterized protein MJ1625 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1625 PE=4 SV=1 540 678 2.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USN8|RQC2_SCHPO Ribosome quality control complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mtr1 PE=1 SV=2 1 694 1.0E-164
sp|Q8CCP0|NEMF_MOUSE Nuclear export mediator factor Nemf OS=Mus musculus GN=Nemf PE=1 SV=2 1 755 8.0E-138
sp|Q12532|RQC2_YEAST Ribosome quality control complex subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RQC2 PE=1 SV=1 1 681 1.0E-120
sp|Q9VBX1|NEMF_DROME Nuclear export mediator factor NEMF homolog OS=Drosophila melanogaster GN=Clbn PE=1 SV=2 1 712 2.0E-112
sp|Q59020|Y1625_METJA Uncharacterized protein MJ1625 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1625 PE=4 SV=1 540 678 2.0E-23
sp|Q59020|Y1625_METJA Uncharacterized protein MJ1625 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1625 PE=4 SV=1 1 124 2.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|891
MKQRFSSLDVKVIAHELNQSLVTLRVANIYDLSSKILLFKFAKPDNKQQLVIDSGFRCHLTDFARATAAAPSAFV
ARLRKFLKTRRLTSVAQVGTDRILEFQFSDGQYRMFLEFFASGNIILTDAHLKILTIARNVPEGESQEPQRVGLQ
YSLDNRQNYHGIPALSKDRVRQALRATVDKAAASDAADKKAKGKSGSSLRKSLATSITELPPVVVDHTLQSNDFD
TTIKPEQILENETLLDELVRLLAEARKTIEDITSATVCTGYIFAKCKEKEAGTDDAASKREDLLYEDFHPFVPKA
QQRNQSIKVVEFQGYNKTVDEFFSSLEGQKLESRLTQREATAKRKLDAARQDQAKRIEGLQEAQAMNFRKAAAIE
ANVDRVQEAMDAVNGLIAQGMDWVDIGKLVEREQKRKNPVAEIIILPLKLSEDIITLRLAEEEMDEGEEEEQDPF
ETDESDSDDEDTVQNADKARQADKSLSVEINLAISPWSNAREYYEQRRSAAAKEEKTQMQATRALKNTEQKINED
LKKGLKQEKALLQPIRKQMWFEKFTWFISSDGYLVIGGKDASQSETLYRKYLRKGDVYCHADIRGACSVIIKNNP
KTPEAPIPPATLSQAGSLSVCSSDAWDSKAGMGAWWVKADQVSKTAATGEFLPAGSFTVQGTKNFLPPAQLLLGL
GVMFKISDESKARHVKHRVGDAAPVESDDAKPGEAEDLAVPAAEEDVSKGSDDDEMAESAAGKVKHDEVPDSESE
EEEHDRESNRANPLQASSPGDGGDGLDVVGGQMQNLDVSERPSTPDATEQQGDEDGVEAASRDGDKSEPATGTSE
VATMASIASTPQSSGTPTSSKKAPAKRGQKGKAKKMANKSGGGRSTSGSSGRRRRTRRSGGR*
Coding >Hirsu2|891
ATGAAGCAGAGATTCTCGTCCTTGGATGTCAAGGTCATTGCACACGAGCTCAACCAGAGCTTGGTGACGCTGCGG
GTGGCCAACATCTATGACCTTTCCTCCAAGATCCTTCTCTTCAAGTTTGCCAAACCCGACAACAAGCAGCAGCTT
GTCATCGACTCCGGCTTTCGATGCCATCTCACCGACTTTGCCCGCGCCACTGCGGCTGCCCCTTCGGCCTTCGTC
GCGAGGCTGCGCAAGTTCCTCAAGACGAGGCGGTTGACGTCTGTTGCGCAAGTGGGCACCGATAGGATACTGGAG
TTTCAGTTCAGCGATGGCCAGTATCGCATGTTTCTCGAATTCTTTGCCAGTGGCAACATTATCCTCACCGACGCC
CACCTGAAGATTCTTACCATCGCGCGCAATGTTCCTGAGGGGGAGAGCCAAGAGCCACAACGAGTTGGCCTACAG
TATTCGTTGGACAACCGACAAAATTATCACGGCATTCCCGCATTGTCCAAGGACCGGGTTCGGCAGGCGTTGAGA
GCGACCGTCGACAAGGCTGCTGCCTCGGATGCGGCGGACAAGAAGGCAAAGGGCAAATCAGGGAGTAGCCTGAGA
AAAAGCCTAGCGACTTCCATCACCGAGCTGCCCCCAGTCGTAGTTGACCATACACTCCAATCCAATGACTTTGAC
ACGACCATCAAGCCTGAGCAAATCTTGGAGAACGAGACGCTCCTGGACGAGCTAGTCCGACTTCTCGCGGAAGCG
CGCAAAACGATCGAAGACATCACATCAGCGACGGTTTGTACCGGCTACATCTTCGCCAAGTGCAAAGAAAAGGAA
GCGGGCACGGACGACGCCGCATCGAAGCGAGAGGATCTTCTTTATGAAGACTTCCACCCCTTTGTGCCAAAGGCA
CAGCAGAGAAACCAATCCATCAAAGTCGTGGAGTTTCAAGGTTACAACAAGACTGTGGACGAGTTCTTTTCGTCG
CTAGAAGGCCAAAAGCTTGAATCTCGCTTGACGCAAAGGGAAGCAACGGCGAAGAGAAAGCTGGACGCAGCAAGG
CAAGACCAAGCCAAGCGGATAGAGGGACTGCAGGAGGCACAGGCGATGAACTTTCGCAAAGCTGCCGCCATAGAA
GCAAACGTGGACCGCGTGCAGGAGGCCATGGACGCAGTAAATGGCCTCATCGCCCAGGGCATGGACTGGGTAGAC
ATTGGAAAGCTGGTTGAGAGAGAGCAGAAGAGGAAGAACCCCGTCGCAGAGATCATCATACTGCCGCTGAAGCTC
TCGGAAGACATCATCACCCTGAGGCTCGCCGAGGAAGAGATGGATGAGGGGGAGGAAGAGGAGCAAGATCCATTC
GAAACGGACGAAAGCGACTCGGACGACGAGGACACCGTACAGAATGCCGACAAAGCCAGGCAGGCCGACAAGAGT
CTATCGGTCGAGATCAACCTCGCCATAAGCCCCTGGAGCAACGCGAGGGAGTATTATGAGCAGAGGCGCTCTGCC
GCCGCCAAGGAAGAAAAGACCCAGATGCAGGCGACGAGAGCTCTGAAGAACACGGAACAAAAGATCAACGAGGAC
TTGAAAAAGGGGCTGAAGCAGGAAAAGGCGCTTCTGCAGCCCATCAGGAAGCAGATGTGGTTCGAGAAGTTCACC
TGGTTCATCTCGTCCGACGGCTATCTGGTGATAGGAGGCAAAGACGCGTCGCAGAGCGAGACGCTTTATCGAAAA
TACCTGCGGAAAGGAGACGTGTACTGCCACGCCGACATACGCGGCGCATGCAGCGTCATCATCAAGAACAACCCG
AAGACGCCAGAGGCCCCTATCCCGCCGGCAACGCTGTCACAGGCCGGGTCGCTCTCGGTCTGCTCATCGGATGCT
TGGGACTCTAAAGCCGGGATGGGGGCGTGGTGGGTCAAGGCCGATCAGGTGTCCAAAACCGCCGCGACGGGGGAG
TTCCTGCCTGCGGGAAGCTTCACGGTGCAAGGGACAAAGAACTTCCTGCCGCCGGCACAGCTTCTGCTCGGCCTC
GGCGTCATGTTTAAAATCAGCGACGAGAGCAAAGCTCGACATGTAAAACATCGGGTGGGCGACGCCGCTCCCGTC
GAAAGCGACGATGCGAAACCGGGCGAAGCAGAAGACCTGGCCGTCCCTGCAGCAGAGGAAGACGTCAGCAAAGGA
AGCGACGACGACGAGATGGCCGAGTCAGCCGCTGGAAAAGTGAAACACGACGAAGTGCCTGATTCGGAGTCGGAA
GAGGAAGAGCACGACCGTGAATCCAACAGGGCCAACCCCCTGCAAGCATCCAGCCCCGGAGACGGCGGCGACGGA
CTGGACGTGGTTGGAGGACAGATGCAGAATCTCGACGTCTCCGAGCGGCCCTCCACACCCGATGCCACGGAGCAG
CAGGGCGACGAGGACGGTGTCGAGGCTGCTTCCCGGGACGGAGACAAATCCGAGCCGGCCACAGGGACATCCGAA
GTGGCGACAATGGCATCCATAGCGTCGACACCACAGTCCAGCGGCACGCCGACGAGCAGCAAGAAGGCGCCGGCC
AAGCGCGGGCAGAAGGGCAAGGCCAAGAAGATGGCCAACAAGAGCGGCGGCGGGCGCAGCACCAGCGGCAGCAGC
GGGAGACGGCGGCGCACGAGGCGAAGCGGCGGGCGATGA
Transcript >Hirsu2|891
ATGAAGCAGAGATTCTCGTCCTTGGATGTCAAGGTCATTGCACACGAGCTCAACCAGAGCTTGGTGACGCTGCGG
GTGGCCAACATCTATGACCTTTCCTCCAAGATCCTTCTCTTCAAGTTTGCCAAACCCGACAACAAGCAGCAGCTT
GTCATCGACTCCGGCTTTCGATGCCATCTCACCGACTTTGCCCGCGCCACTGCGGCTGCCCCTTCGGCCTTCGTC
GCGAGGCTGCGCAAGTTCCTCAAGACGAGGCGGTTGACGTCTGTTGCGCAAGTGGGCACCGATAGGATACTGGAG
TTTCAGTTCAGCGATGGCCAGTATCGCATGTTTCTCGAATTCTTTGCCAGTGGCAACATTATCCTCACCGACGCC
CACCTGAAGATTCTTACCATCGCGCGCAATGTTCCTGAGGGGGAGAGCCAAGAGCCACAACGAGTTGGCCTACAG
TATTCGTTGGACAACCGACAAAATTATCACGGCATTCCCGCATTGTCCAAGGACCGGGTTCGGCAGGCGTTGAGA
GCGACCGTCGACAAGGCTGCTGCCTCGGATGCGGCGGACAAGAAGGCAAAGGGCAAATCAGGGAGTAGCCTGAGA
AAAAGCCTAGCGACTTCCATCACCGAGCTGCCCCCAGTCGTAGTTGACCATACACTCCAATCCAATGACTTTGAC
ACGACCATCAAGCCTGAGCAAATCTTGGAGAACGAGACGCTCCTGGACGAGCTAGTCCGACTTCTCGCGGAAGCG
CGCAAAACGATCGAAGACATCACATCAGCGACGGTTTGTACCGGCTACATCTTCGCCAAGTGCAAAGAAAAGGAA
GCGGGCACGGACGACGCCGCATCGAAGCGAGAGGATCTTCTTTATGAAGACTTCCACCCCTTTGTGCCAAAGGCA
CAGCAGAGAAACCAATCCATCAAAGTCGTGGAGTTTCAAGGTTACAACAAGACTGTGGACGAGTTCTTTTCGTCG
CTAGAAGGCCAAAAGCTTGAATCTCGCTTGACGCAAAGGGAAGCAACGGCGAAGAGAAAGCTGGACGCAGCAAGG
CAAGACCAAGCCAAGCGGATAGAGGGACTGCAGGAGGCACAGGCGATGAACTTTCGCAAAGCTGCCGCCATAGAA
GCAAACGTGGACCGCGTGCAGGAGGCCATGGACGCAGTAAATGGCCTCATCGCCCAGGGCATGGACTGGGTAGAC
ATTGGAAAGCTGGTTGAGAGAGAGCAGAAGAGGAAGAACCCCGTCGCAGAGATCATCATACTGCCGCTGAAGCTC
TCGGAAGACATCATCACCCTGAGGCTCGCCGAGGAAGAGATGGATGAGGGGGAGGAAGAGGAGCAAGATCCATTC
GAAACGGACGAAAGCGACTCGGACGACGAGGACACCGTACAGAATGCCGACAAAGCCAGGCAGGCCGACAAGAGT
CTATCGGTCGAGATCAACCTCGCCATAAGCCCCTGGAGCAACGCGAGGGAGTATTATGAGCAGAGGCGCTCTGCC
GCCGCCAAGGAAGAAAAGACCCAGATGCAGGCGACGAGAGCTCTGAAGAACACGGAACAAAAGATCAACGAGGAC
TTGAAAAAGGGGCTGAAGCAGGAAAAGGCGCTTCTGCAGCCCATCAGGAAGCAGATGTGGTTCGAGAAGTTCACC
TGGTTCATCTCGTCCGACGGCTATCTGGTGATAGGAGGCAAAGACGCGTCGCAGAGCGAGACGCTTTATCGAAAA
TACCTGCGGAAAGGAGACGTGTACTGCCACGCCGACATACGCGGCGCATGCAGCGTCATCATCAAGAACAACCCG
AAGACGCCAGAGGCCCCTATCCCGCCGGCAACGCTGTCACAGGCCGGGTCGCTCTCGGTCTGCTCATCGGATGCT
TGGGACTCTAAAGCCGGGATGGGGGCGTGGTGGGTCAAGGCCGATCAGGTGTCCAAAACCGCCGCGACGGGGGAG
TTCCTGCCTGCGGGAAGCTTCACGGTGCAAGGGACAAAGAACTTCCTGCCGCCGGCACAGCTTCTGCTCGGCCTC
GGCGTCATGTTTAAAATCAGCGACGAGAGCAAAGCTCGACATGTAAAACATCGGGTGGGCGACGCCGCTCCCGTC
GAAAGCGACGATGCGAAACCGGGCGAAGCAGAAGACCTGGCCGTCCCTGCAGCAGAGGAAGACGTCAGCAAAGGA
AGCGACGACGACGAGATGGCCGAGTCAGCCGCTGGAAAAGTGAAACACGACGAAGTGCCTGATTCGGAGTCGGAA
GAGGAAGAGCACGACCGTGAATCCAACAGGGCCAACCCCCTGCAAGCATCCAGCCCCGGAGACGGCGGCGACGGA
CTGGACGTGGTTGGAGGACAGATGCAGAATCTCGACGTCTCCGAGCGGCCCTCCACACCCGATGCCACGGAGCAG
CAGGGCGACGAGGACGGTGTCGAGGCTGCTTCCCGGGACGGAGACAAATCCGAGCCGGCCACAGGGACATCCGAA
GTGGCGACAATGGCATCCATAGCGTCGACACCACAGTCCAGCGGCACGCCGACGAGCAGCAAGAAGGCGCCGGCC
AAGCGCGGGCAGAAGGGCAAGGCCAAGAAGATGGCCAACAAGAGCGGCGGCGGGCGCAGCACCAGCGGCAGCAGC
GGGAGACGGCGGCGCACGAGGCGAAGCGGCGGGCGATGA
Gene >Hirsu2|891
ATGAAGCAGAGATTCTCGTCCTTGGATGTCAAGGTGCGTCAAGCCCCGGCCACAGCTGGTGACGCAATCGGCTCC
TGACTGTGTCGCCCTGCAGGTCATTGCACACGAGCTCAACCAGAGCTTGGTGACGCTGCGGGTGGCCAACATCTA
TGACCTTTCCTCCAAGATCCTTCTCTTCAAGTTTGCCAAACCCGACAACAAGCAGCAGCTTGTCATCGACTCCGG
CTTTCGATGCCATCTCACCGACTTTGCCCGCGCCACTGCGGCTGCCCCTTCGGCCTTCGTCGCGAGGCTGCGCAA
GTTCCTCAAGACGAGGCGGTTGACGTCTGTTGCGCAAGTGGGCACCGATAGGATACTGGAGTTTCAGTTCAGCGA
TGGCCAGTATCGCATGTTTCTCGAATTCTTTGCCGTGAGATATCCCCACGTTGGCAGCCTCTGGGCCCCGAACAG
TACAGACTGACTTGGCCGGAAGAGTGGCAACATTATCCTCACCGACGCCCACCTGAAGATTCTTACCATCGCGCG
CAATGTTCCTGAGGGGGAGAGCCAAGAGCCACAACGAGTTGGCCTACAGTATTCGTTGGACAACCGACAAAATTA
TCACGGCATTCCCGCATTGTCCAAGGACCGGGTTCGGCAGGCGTTGAGAGCGACCGTCGACAAGGCTGCTGCCTC
GGATGCGGCGGACAAGAAGGCAAAGGGCAAATCAGGGAGTAGCCTGAGAAAAAGCCTAGCGACTTCCATCACCGA
GCTGCCCCCAGTCGTAGTTGACCATACACTCCAATCCAATGACTTTGACACGACCATCAAGCCTGAGCAAATCTT
GGAGAACGAGACGCTCCTGGACGAGCTAGTCCGACTTCTCGCGGAAGCGCGCAAAACGATCGAAGACATCACATC
AGCGACGGTTTGTACCGGCTACATCTTCGCCAAGTGCAAAGAAAAGGAAGCGGGCACGGACGACGCCGCATCGAA
GCGAGAGGATCTTCTTTATGAAGACTTCCACCCCTTTGTGCCAAAGGCACAGCAGAGAAACCAATCCATCAAAGT
CGTGGAGTTTCAAGGTTACAACAAGACTGTGGACGAGTTCTTTTCGTCGCTAGAAGGCCAAAAGCTTGAATCTCG
CTTGACGCAAAGGGAAGCAACGGCGAAGAGAAAGCTGGACGCAGCAAGGCAAGACCAAGCCAAGCGGATAGAGGG
ACTGCAGGAGGCACAGGCGATGAACTTTCGCAAAGCTGCCGCCATAGAAGCAAACGTGGACCGCGTGCAGGAGGC
CATGGACGCAGTAAATGGCCTCATCGCCCAGGGCATGGACTGGGTAGACATTGGAAAGCTGGTTGAGAGAGAGCA
GAAGAGGAAGAACCCCGTCGCAGAGATCATCATACTGCCGCTGAAGCTCTCGGAAGACATCATCACCCTGAGGCT
CGCCGAGGAAGAGATGGATGAGGGGGAGGAAGAGGAGCAAGATCCATTCGAAACGGACGAAAGCGACTCGGACGA
CGAGGACACCGTACAGAATGCCGACAAAGCCAGGCAGGCCGACAAGAGTCTATCGGTCGAGATCAACCTCGCCAT
AAGCCCCTGGAGCAACGCGAGGGAGTATTATGAGCAGAGGCGCTCTGCCGCCGCCAAGGAAGAAAAGACCCAGAT
GCAGGCGACGAGAGCTCTGAAGAACACGGAACAAAAGATCAACGAGGACTTGAAAAAGGGGCTGAAGCAGGAAAA
GGCGCTTCTGCAGCCCATCAGGAAGCAGATGTGGTTCGAGAAGTTCACCTGGTTCATCTCGTCCGACGGCTATCT
GGTGATAGGAGGCAAAGACGCGTCGCAGAGCGAGACGCTTTATCGAAAATACCTGCGGAAAGGAGACGTGTACTG
CCACGCCGACATACGCGGCGCATGCAGCGTCATCATCAAGAACAACCCGAAGACGCCAGAGGCCCCTATCCCGCC
GGCAACGCTGTCACAGGCCGGGTCGCTCTCGGTCTGCTCATCGGATGCTTGGGACTCTAAAGCCGGGATGGGGGC
GTGGTGGGTCAAGGCCGATCAGGTGTCCAAAACCGCCGCGACGGGGGAGTTCCTGCCTGCGGGAAGCTTCACGGT
GCAAGGGACAAAGAACTTCCTGCCGCCGGCACAGCTTCTGCTCGGCCTCGGCGTCATGTTTAAAATCAGCGACGA
GAGCAAAGCTCGACATGTAAAACATCGGGTGGGCGACGCCGCTCCCGTCGAAAGCGACGATGCGAAACCGGGCGA
AGCAGAAGACCTGGCCGTCCCTGCAGCAGAGGAAGACGTCAGCAAAGGAAGCGACGACGACGAGATGGCCGAGTC
AGCCGCTGGAAAAGTGAAACACGACGAAGTGCCTGATTCGGAGTCGGAAGAGGAAGAGCACGACCGTGAATCCAA
CAGGGCCAACCCCCTGCAAGCATCCAGCCCCGGAGACGGCGGCGACGGACTGGACGTGGTTGGAGGACAGATGCA
GAATCTCGACGTCTCCGAGCGGCCCTCCACACCCGATGCCACGGAGCAGCAGGGCGACGAGGACGGTGTCGAGGC
TGCTTCCCGGGACGGAGACAAATCCGAGCCGGCCACAGGGACATCCGAAGTGGCGACAATGGCATCCATAGCGTC
GACACCACAGTCCAGCGGCACGCCGACGAGCAGCAAGAAGGCGCCGGCCAAGCGCGGGCAGAAGGGCAAGGCCAA
GAAGATGGCCAACAAGTACAAGGACCAAGACGAAGAGGACCGCGCGGCGGCGGAAGCGCTCATCGGCGCCACGGC
CGGGCGGCAGCGGGCCGAAGCAGAGGCCAAGGCGCGGGCCGAGGCGCGGGCCGAGCTCGAGGCGGCCAAGGAGCG
GCGGCGGGCGCAGCACCAGCGGCAGCAGCGGGAGACGGCGGCGCACGAGGCGAAGCGGCGGGCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail