Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8906
Gene name
LocationContig_610:3521..4337
Strand+
Gene length (bp)816
Transcript length (bp)678
Coding sequence length (bp)678
Protein length (aa) 226

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00098 zf-CCHC Zinc knuckle 3.6E-04 7 23
PF00098 zf-CCHC Zinc knuckle 1.9E-04 28 43
PF00098 zf-CCHC Zinc knuckle 3.5E-05 52 67
PF00098 zf-CCHC Zinc knuckle 8.8E-08 79 95
PF00098 zf-CCHC Zinc knuckle 8.6E-07 129 144
PF00098 zf-CCHC Zinc knuckle 2.3E-07 149 164
PF00098 zf-CCHC Zinc knuckle 7.0E-08 176 193
PF14392 zf-CCHC_4 Zinc knuckle 2.6E-01 6 23
PF14392 zf-CCHC_4 Zinc knuckle 7.0E-01 27 43
PF14392 zf-CCHC_4 Zinc knuckle 3.8E+00 53 67
PF14392 zf-CCHC_4 Zinc knuckle 9.8E-01 80 94
PF14392 zf-CCHC_4 Zinc knuckle 6.1E-01 150 164
PF14392 zf-CCHC_4 Zinc knuckle 8.5E-01 176 192

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 4 193 4.0E-44
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 3 198 5.0E-33
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 9 191 4.0E-25
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 9 192 7.0E-22
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 29 198 4.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 4 193 4.0E-44
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 3 198 5.0E-33
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 9 191 4.0E-25
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 9 192 7.0E-22
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 29 198 4.0E-20
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 4 192 2.0E-18
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 4 192 3.0E-18
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 4 192 3.0E-18
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 4 192 3.0E-18
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 4 192 3.0E-18
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 4 192 3.0E-18
sp|Q8T8R1|Y3800_DROME CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 8 168 3.0E-17
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 47 201 7.0E-16
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 76 197 2.0E-15
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 9 166 2.0E-15
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 76 197 2.0E-15
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 9 166 2.0E-15
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 76 197 2.0E-15
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 9 166 2.0E-15
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 76 197 8.0E-15
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 38 193 2.0E-14
sp|Q94C69|CSP3_ARATH Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 29 194 2.0E-14
sp|Q94C69|CSP3_ARATH Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 9 165 2.0E-13
sp|Q8T8R1|Y3800_DROME CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 80 204 5.0E-13
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 80 202 8.0E-13
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 9 147 2.0E-12
sp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 71 192 1.0E-10
sp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 14 124 2.0E-10
sp|P24740|POL_HV1U4 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate U455) GN=gag-pol PE=1 SV=3 80 195 4.0E-10
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 1 95 8.0E-10
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 8 93 2.0E-09
sp|Q9QSR3|POL_HV1VI Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate VI850) GN=gag-pol PE=3 SV=3 65 208 2.0E-09
sp|Q94C69|CSP3_ARATH Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 52 197 6.0E-09
sp|P20875|POL_HV1JR Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate JRCSF) GN=gag-pol PE=1 SV=3 80 208 1.0E-08
sp|Q8N567|ZCHC9_HUMAN Zinc finger CCHC domain-containing protein 9 OS=Homo sapiens GN=ZCCHC9 PE=2 SV=2 53 202 1.0E-08
sp|Q9QBZ9|POL_HV197 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 97ZR-EQTB11) GN=gag-pol PE=3 SV=2 80 197 1.0E-08
sp|P12499|POL_HV1Z2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate Z2/CDC-Z34) GN=gag-pol PE=1 SV=3 80 208 2.0E-08
sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 9 99 3.0E-08
sp|Q9Q720|POL_HV1V9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate VI991) GN=gag-pol PE=3 SV=3 80 208 3.0E-08
sp|Q9QBZ1|POL_HV1M2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP257) GN=gag-pol PE=3 SV=3 130 197 4.0E-08
sp|O12158|POL_HV192 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate 92BR025) GN=gag-pol PE=1 SV=2 130 197 4.0E-08
sp|P03367|POL_HV1BR Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) GN=gag-pol PE=1 SV=3 80 197 4.0E-08
sp|Q8R1J3|ZCHC9_MOUSE Zinc finger CCHC domain-containing protein 9 OS=Mus musculus GN=Zcchc9 PE=2 SV=2 53 225 4.0E-08
sp|Q9QBY3|POL_HV196 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 96CM-MP535) GN=gag-pol PE=3 SV=3 130 197 4.0E-08
sp|Q9QBZ5|POL_HV1MP Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP255) GN=gag-pol PE=3 SV=3 80 208 5.0E-08
sp|P0C6F2|POL_HV1LW Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate LW123) GN=gag-pol PE=1 SV=1 80 197 5.0E-08
sp|P04587|POL_HV1B5 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH5) GN=gag-pol PE=1 SV=3 130 197 6.0E-08
sp|O76743|GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 27 163 6.0E-08
sp|Q73368|POL_HV1B9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (strain 89.6) GN=gag-pol PE=3 SV=3 80 197 8.0E-08
sp|P04588|POL_HV1MA Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate MAL) GN=gag-pol PE=1 SV=3 80 208 8.0E-08
sp|P35963|POL_HV1Y2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) GN=gag-pol PE=1 SV=3 80 197 8.0E-08
sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 29 194 1.0E-07
sp|P04587|POL_HV1B5 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH5) GN=gag-pol PE=1 SV=3 80 164 1.0E-07
sp|P03366|POL_HV1B1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) GN=gag-pol PE=1 SV=3 80 164 1.0E-07
sp|P20892|POL_HV1OY Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate OYI) GN=gag-pol PE=3 SV=3 130 197 1.0E-07
sp|Q9WC63|POL_HV1S9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9173) GN=gag-pol PE=3 SV=3 130 197 1.0E-07
sp|O89940|POL_HV1SE Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate SE6165) GN=gag-pol PE=3 SV=3 130 197 1.0E-07
sp|O89940|POL_HV1SE Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate SE6165) GN=gag-pol PE=3 SV=3 80 195 1.0E-07
sp|Q9WC54|POL_HV1S2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9280) GN=gag-pol PE=3 SV=3 130 197 1.0E-07
sp|Q75002|POL_HV1ET Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate ETH2220) GN=gag-pol PE=3 SV=3 130 197 1.0E-07
sp|Q8AII1|POL_SIVTN Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate TAN1) GN=gag-pol PE=3 SV=4 80 195 1.0E-07
sp|P12451|POL_HV2SB Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate SBLISY) GN=gag-pol PE=3 SV=3 135 194 1.0E-07
sp|P12497|POL_HV1N5 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate NY5) GN=gag-pol PE=1 SV=4 80 208 2.0E-07
sp|P24736|GAG_HV1U4 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate U455) GN=gag PE=1 SV=3 80 174 2.0E-07
sp|P03369|POL_HV1A2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2) GN=gag-pol PE=1 SV=3 80 208 2.0E-07
sp|P04585|POL_HV1H2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) GN=gag-pol PE=1 SV=4 80 197 2.0E-07
sp|P04589|POL_HV1EL Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate ELI) GN=gag-pol PE=3 SV=3 130 197 2.0E-07
sp|P18802|POL_HV1ND Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate NDK) GN=gag-pol PE=3 SV=3 80 197 2.0E-07
sp|Q8AII2|GAG_SIVTN Gag polyprotein OS=Simian immunodeficiency virus (isolate TAN1) GN=gag PE=3 SV=3 80 223 2.0E-07
sp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 9 67 3.0E-07
sp|O93215|POL_HV190 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate 90CF056) GN=gag-pol PE=3 SV=4 130 194 3.0E-07
sp|P05961|POL_HV1MN Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate MN) GN=gag-pol PE=1 SV=3 80 197 3.0E-07
sp|Q82851|POL_JEMBR Gag-Pol polyprotein OS=Jembrana disease virus GN=gag-pol PE=3 SV=1 96 167 3.0E-07
sp|O12158|POL_HV192 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate 92BR025) GN=gag-pol PE=1 SV=2 80 208 4.0E-07
sp|Q75002|POL_HV1ET Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate ETH2220) GN=gag-pol PE=3 SV=3 80 202 4.0E-07
sp|P34689|GLH1_CAEEL ATP-dependent RNA helicase glh-1 OS=Caenorhabditis elegans GN=glh-1 PE=1 SV=3 9 99 4.0E-07
sp|P05959|POL_HV1RH Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate RF/HAT3) GN=gag-pol PE=1 SV=3 130 191 4.0E-07
sp|P04584|POL_HV2RO Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) GN=gag-pol PE=1 SV=3 135 194 4.0E-07
sp|Q9QBZ1|POL_HV1M2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP257) GN=gag-pol PE=3 SV=3 80 216 5.0E-07
sp|P04589|POL_HV1EL Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate ELI) GN=gag-pol PE=3 SV=3 80 208 5.0E-07
sp|O76743|GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 7 95 6.0E-07
sp|Q9WC63|POL_HV1S9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9173) GN=gag-pol PE=3 SV=3 80 164 6.0E-07
sp|O89290|POL_HV193 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate 93BR020) GN=gag-pol PE=3 SV=3 130 194 6.0E-07
sp|Q9WC54|POL_HV1S2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9280) GN=gag-pol PE=3 SV=3 80 164 7.0E-07
sp|P05960|POL_HV1C4 Gag-Pol polyprotein (Fragment) OS=Human immunodeficiency virus type 1 group M subtype B (isolate CDC-451) GN=gag-pol PE=3 SV=3 80 208 7.0E-07
sp|P17757|POL_HV2D1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate D194) GN=gag-pol PE=3 SV=3 135 194 7.0E-07
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 9 97 8.0E-07
sp|Q9QBY3|POL_HV196 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 96CM-MP535) GN=gag-pol PE=3 SV=3 80 208 8.0E-07
sp|O93215|POL_HV190 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate 90CF056) GN=gag-pol PE=3 SV=4 80 164 9.0E-07
sp|Q02836|POL_SIVG1 Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.grivet (isolate AGM gr-1) GN=gag-pol PE=3 SV=2 124 163 9.0E-07
sp|Q82851|POL_JEMBR Gag-Pol polyprotein OS=Jembrana disease virus GN=gag-pol PE=3 SV=1 145 195 1.0E-06
sp|P19505|POL_SIVSP Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate PBj14/BCL-3) GN=gag-pol PE=1 SV=2 92 194 1.0E-06
sp|Q74120|POL_HV2KR Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate KR) GN=gag-pol PE=3 SV=3 144 217 1.0E-06
sp|Q82850|GAG_JEMBR Gag polyprotein OS=Jembrana disease virus GN=gag PE=3 SV=1 91 168 1.0E-06
sp|P24107|POL_HV2CA Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate CAM2) GN=gag-pol PE=3 SV=3 136 194 1.0E-06
sp|Q1A267|POL_SIVMB Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate MB66) GN=gag-pol PE=3 SV=4 119 191 1.0E-06
sp|P20876|POL_HV2ST Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ST) GN=gag-pol PE=3 SV=3 144 217 1.0E-06
sp|Q9QC00|GAG_HV197 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 97ZR-EQTB11) GN=gag PE=3 SV=2 80 197 1.0E-06
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 2 94 2.0E-06
sp|Q8R1J3|ZCHC9_MOUSE Zinc finger CCHC domain-containing protein 9 OS=Mus musculus GN=Zcchc9 PE=2 SV=2 28 144 2.0E-06
sp|P05959|POL_HV1RH Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate RF/HAT3) GN=gag-pol PE=1 SV=3 80 208 2.0E-06
sp|Q02836|POL_SIVG1 Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.grivet (isolate AGM gr-1) GN=gag-pol PE=3 SV=2 148 197 2.0E-06
sp|P05888|GAG_HV1MN Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate MN) GN=gag PE=1 SV=3 80 178 2.0E-06
sp|P17283|POL_SIVCZ Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate CPZ GAB1) GN=gag-pol PE=3 SV=2 130 197 2.0E-06
sp|Q1A249|POL_SIVEK Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate EK505) GN=gag-pol PE=3 SV=3 80 163 2.0E-06
sp|P20892|POL_HV1OY Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate OYI) GN=gag-pol PE=3 SV=3 80 208 3.0E-06
sp|Q9IDV9|POL_HV1YB Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group N (isolate YBF106) GN=gag-pol PE=1 SV=3 130 191 3.0E-06
sp|P05887|GAG_HV1C4 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate CDC-451) GN=gag PE=3 SV=3 80 197 3.0E-06
sp|P18042|POL_HV2G1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate Ghana-1) GN=gag-pol PE=1 SV=4 136 194 3.0E-06
sp|Q9QBZ6|GAG_HV1MP Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP255) GN=gag PE=3 SV=2 80 174 3.0E-06
sp|P04593|GAG_HV1B5 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH5) GN=gag PE=3 SV=3 80 174 3.0E-06
sp|P12498|POL_HV1J3 Gag-Pol polyprotein (Fragment) OS=Human immunodeficiency virus type 1 group M subtype B (isolate JH32) GN=gag-pol PE=3 SV=4 80 208 3.0E-06
sp|P17283|POL_SIVCZ Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate CPZ GAB1) GN=gag-pol PE=3 SV=2 80 165 4.0E-06
sp|Q9QSR4|GAG_HV1VI Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate VI850) GN=gag PE=3 SV=3 65 174 4.0E-06
sp|Q70622|GAG_HV1LW Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate LW123) GN=gag PE=1 SV=3 80 197 4.0E-06
sp|O41798|POL_HV19N Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate 92NG083) GN=gag-pol PE=3 SV=3 118 208 4.0E-06
sp|P34689|GLH1_CAEEL ATP-dependent RNA helicase glh-1 OS=Caenorhabditis elegans GN=glh-1 PE=1 SV=3 29 166 5.0E-06
sp|P03347|GAG_HV1B1 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) GN=gag PE=1 SV=3 80 174 5.0E-06
sp|P03348|GAG_HV1BR Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) GN=gag PE=1 SV=3 80 197 5.0E-06
sp|O89290|POL_HV193 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate 93BR020) GN=gag-pol PE=3 SV=3 80 164 6.0E-06
sp|Q1A267|POL_SIVMB Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate MB66) GN=gag-pol PE=3 SV=4 84 208 6.0E-06
sp|Q9QSR4|GAG_HV1VI Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate VI850) GN=gag PE=3 SV=3 130 197 6.0E-06
sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 46 192 7.0E-06
sp|Q9QBZ6|GAG_HV1MP Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP255) GN=gag PE=3 SV=2 144 197 7.0E-06
sp|P04593|GAG_HV1B5 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH5) GN=gag PE=3 SV=3 144 197 7.0E-06
sp|P18096|POL_HV2BE Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate BEN) GN=gag-pol PE=3 SV=4 136 217 7.0E-06
sp|P12494|GAG_HV1J3 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate JH32) GN=gag PE=3 SV=3 80 178 8.0E-06
sp|P35962|GAG_HV1Y2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) GN=gag PE=1 SV=2 80 197 8.0E-06
sp|Q73367|GAG_HV1B9 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (strain 89.6) GN=gag PE=3 SV=3 80 197 8.0E-06
sp|Q9QBZ2|GAG_HV1M2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP257) GN=gag PE=3 SV=2 130 197 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0003676 nucleic acid binding Yes
GO:0097159 organic cyclic compound binding No
GO:0046872 metal ion binding No
GO:0046914 transition metal ion binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, CCHC-type

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8906
MSSLSRRACYKCGNVGHYAEVCSSAERLCYNCKQPGHESNSCPLPRTTEAKQCYHCQGLGHVQADCPTLRLSGTP
TGGRCYNCGQPGHLARACPNPVGPMGRGAPPMARGGYAPGFARGAFPGGPRPATCYKCGGPNHFARDCQAQAMKC
YACGKLGHISRDCTAPNGGPLNTVGKTCYQCGEAGHISRDCPQKNPNGEMPTDVEMQVGAVPAAPAPVAPIAPVA
*
Coding >Hirsu2|8906
ATGTCCTCACTCTCCCGCCGCGCCTGCTACAAATGCGGCAACGTTGGCCATTACGCCGAGGTGTGCTCCTCTGCC
GAGCGGCTCTGCTACAACTGCAAGCAGCCGGGCCACGAGTCCAACAGCTGTCCCCTGCCCCGCACGACCGAGGCC
AAGCAATGCTACCACTGCCAGGGCCTCGGCCACGTCCAGGCTGATTGCCCGACGCTGCGCTTGAGCGGGACCCCC
ACGGGCGGGCGCTGCTACAACTGCGGCCAGCCCGGCCACCTCGCTCGCGCATGCCCCAACCCCGTGGGCCCCATG
GGTCGCGGCGCCCCCCCCATGGCCCGCGGCGGATACGCCCCTGGCTTCGCCCGCGGCGCCTTTCCCGGCGGCCCT
CGCCCGGCGACCTGCTACAAATGCGGCGGGCCCAACCACTTTGCCCGTGATTGCCAGGCGCAAGCGATGAAGTGC
TACGCCTGCGGCAAGCTGGGCCACATCTCGCGCGACTGCACCGCCCCGAACGGCGGCCCCCTGAACACGGTGGGC
AAGACTTGCTACCAATGTGGCGAGGCTGGCCACATCTCGAGGGATTGCCCACAGAAGAATCCCAACGGCGAGATG
CCCACTGACGTCGAGATGCAGGTCGGCGCCGTCCCGGCCGCCCCCGCCCCCGTGGCGCCCATTGCCCCAGTGGCA
TAG
Transcript >Hirsu2|8906
ATGTCCTCACTCTCCCGCCGCGCCTGCTACAAATGCGGCAACGTTGGCCATTACGCCGAGGTGTGCTCCTCTGCC
GAGCGGCTCTGCTACAACTGCAAGCAGCCGGGCCACGAGTCCAACAGCTGTCCCCTGCCCCGCACGACCGAGGCC
AAGCAATGCTACCACTGCCAGGGCCTCGGCCACGTCCAGGCTGATTGCCCGACGCTGCGCTTGAGCGGGACCCCC
ACGGGCGGGCGCTGCTACAACTGCGGCCAGCCCGGCCACCTCGCTCGCGCATGCCCCAACCCCGTGGGCCCCATG
GGTCGCGGCGCCCCCCCCATGGCCCGCGGCGGATACGCCCCTGGCTTCGCCCGCGGCGCCTTTCCCGGCGGCCCT
CGCCCGGCGACCTGCTACAAATGCGGCGGGCCCAACCACTTTGCCCGTGATTGCCAGGCGCAAGCGATGAAGTGC
TACGCCTGCGGCAAGCTGGGCCACATCTCGCGCGACTGCACCGCCCCGAACGGCGGCCCCCTGAACACGGTGGGC
AAGACTTGCTACCAATGTGGCGAGGCTGGCCACATCTCGAGGGATTGCCCACAGAAGAATCCCAACGGCGAGATG
CCCACTGACGTCGAGATGCAGGTCGGCGCCGTCCCGGCCGCCCCCGCCCCCGTGGCGCCCATTGCCCCAGTGGCA
TAG
Gene >Hirsu2|8906
ATGTCCTCACTCTCCCGCCGCGCCTGCTACAAATGCGGCAACGTTGGCCATTACGCCGAGGTGTGCTCCTCTGCC
GAGCGGCTCTGCTACAACTGTACGTCTCCCCCCCGCTGCGACGCCGCCCGGCCTGTCCCCCGGCCGTCCGTACGC
CGACTAACCTCGTCCCTCCAGGCAAGCAGCCGGGCCACGAGTCCAACAGCTGTCCCCTGCCCCGCACGACCGAGG
CCAAGCAATGCTACCACTGCCAGGGCCTCGGCCACGTCCAGGCTGATTGCCCGACGCTGCGCTTGAGCGGGACCC
CCACGGGCGGGCGCTGCTACAACTGCGGCCAGCCCGGCCACCTCGCTGTACGTCCTTGTCGGCACCGCCCTTACC
GCGCCGCCCCCTTGACTGACGGCCTGTGCACAGCGCGCATGCCCCAACCCCGTGGGCCCCATGGGTCGCGGCGCC
CCCCCCATGGCCCGCGGCGGATACGCCCCTGGCTTCGCCCGCGGCGCCTTTCCCGGCGGCCCTCGCCCGGCGACC
TGCTACAAATGCGGCGGGCCCAACCACTTTGCCCGTGATTGCCAGGCGCAAGCGATGAAGTGCTACGCCTGCGGC
AAGCTGGGCCACATCTCGCGCGACTGCACCGCCCCGAACGGCGGCCCCCTGAACACGGTGGGCAAGACTTGCTAC
CAATGTGGCGAGGCTGGCCACATCTCGAGGGATTGCCCACAGAAGAATCCCAACGGCGAGATGCCCACTGACGTC
GAGATGCAGGTCGGCGCCGTCCCGGCCGCCCCCGCCCCCGTGGCGCCCATTGCCCCAGTGGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail