© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|8906 |
| Gene name | |
| Location | Contig_610:3521..4337 |
| Strand | + |
| Gene length (bp) | 816 |
| Transcript length (bp) | 678 |
| Coding sequence length (bp) | 678 |
| Protein length (aa) | 226 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00098 | zf-CCHC | Zinc knuckle | 3.6E-04 | 7 | 23 |
| PF00098 | zf-CCHC | Zinc knuckle | 1.9E-04 | 28 | 43 |
| PF00098 | zf-CCHC | Zinc knuckle | 3.5E-05 | 52 | 67 |
| PF00098 | zf-CCHC | Zinc knuckle | 8.8E-08 | 79 | 95 |
| PF00098 | zf-CCHC | Zinc knuckle | 8.6E-07 | 129 | 144 |
| PF00098 | zf-CCHC | Zinc knuckle | 2.3E-07 | 149 | 164 |
| PF00098 | zf-CCHC | Zinc knuckle | 7.0E-08 | 176 | 193 |
| PF14392 | zf-CCHC_4 | Zinc knuckle | 2.6E-01 | 6 | 23 |
| PF14392 | zf-CCHC_4 | Zinc knuckle | 7.0E-01 | 27 | 43 |
| PF14392 | zf-CCHC_4 | Zinc knuckle | 3.8E+00 | 53 | 67 |
| PF14392 | zf-CCHC_4 | Zinc knuckle | 9.8E-01 | 80 | 94 |
| PF14392 | zf-CCHC_4 | Zinc knuckle | 6.1E-01 | 150 | 164 |
| PF14392 | zf-CCHC_4 | Zinc knuckle | 8.5E-01 | 176 | 192 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P53849|GIS2_YEAST | Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 | 4 | 193 | 4.0E-44 |
| sp|Q04832|HEXP_LEIMA | DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 | 3 | 198 | 5.0E-33 |
| sp|P36627|BYR3_SCHPO | Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 | 9 | 191 | 4.0E-25 |
| sp|O65639|CSP1_ARATH | Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 | 9 | 192 | 7.0E-22 |
| sp|O65639|CSP1_ARATH | Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 | 29 | 198 | 4.0E-20 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P53849|GIS2_YEAST | Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 | 4 | 193 | 4.0E-44 |
| sp|Q04832|HEXP_LEIMA | DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 | 3 | 198 | 5.0E-33 |
| sp|P36627|BYR3_SCHPO | Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 | 9 | 191 | 4.0E-25 |
| sp|O65639|CSP1_ARATH | Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 | 9 | 192 | 7.0E-22 |
| sp|O65639|CSP1_ARATH | Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 | 29 | 198 | 4.0E-20 |
| sp|O42395|CNBP_CHICK | Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 | 4 | 192 | 2.0E-18 |
| sp|P53996|CNBP_MOUSE | Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 | 4 | 192 | 3.0E-18 |
| sp|P62634|CNBP_RAT | Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 | 4 | 192 | 3.0E-18 |
| sp|Q5R5R5|CNBP_PONAB | Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 | 4 | 192 | 3.0E-18 |
| sp|P62633|CNBP_HUMAN | Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 | 4 | 192 | 3.0E-18 |
| sp|Q3T0Q6|CNBP_BOVIN | Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 | 4 | 192 | 3.0E-18 |
| sp|Q8T8R1|Y3800_DROME | CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 | 8 | 168 | 3.0E-17 |
| sp|Q8WW36|ZCH13_HUMAN | Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 | 47 | 201 | 7.0E-16 |
| sp|P62634|CNBP_RAT | Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 | 76 | 197 | 2.0E-15 |
| sp|P62634|CNBP_RAT | Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 | 9 | 166 | 2.0E-15 |
| sp|Q5R5R5|CNBP_PONAB | Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 | 76 | 197 | 2.0E-15 |
| sp|Q5R5R5|CNBP_PONAB | Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 | 9 | 166 | 2.0E-15 |
| sp|P62633|CNBP_HUMAN | Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 | 76 | 197 | 2.0E-15 |
| sp|P62633|CNBP_HUMAN | Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 | 9 | 166 | 2.0E-15 |
| sp|Q3T0Q6|CNBP_BOVIN | Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 | 76 | 197 | 8.0E-15 |
| sp|P36627|BYR3_SCHPO | Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 | 38 | 193 | 2.0E-14 |
| sp|Q94C69|CSP3_ARATH | Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 | 29 | 194 | 2.0E-14 |
| sp|Q94C69|CSP3_ARATH | Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 | 9 | 165 | 2.0E-13 |
| sp|Q8T8R1|Y3800_DROME | CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 | 80 | 204 | 5.0E-13 |
| sp|O65639|CSP1_ARATH | Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 | 80 | 202 | 8.0E-13 |
| sp|O65639|CSP1_ARATH | Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 | 9 | 147 | 2.0E-12 |
| sp|Q65XV7|RFA1C_ORYSJ | Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 | 71 | 192 | 1.0E-10 |
| sp|Q65XV7|RFA1C_ORYSJ | Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 | 14 | 124 | 2.0E-10 |
| sp|P24740|POL_HV1U4 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate U455) GN=gag-pol PE=1 SV=3 | 80 | 195 | 4.0E-10 |
| sp|Q04832|HEXP_LEIMA | DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 | 1 | 95 | 8.0E-10 |
| sp|Q8WW36|ZCH13_HUMAN | Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 | 8 | 93 | 2.0E-09 |
| sp|Q9QSR3|POL_HV1VI | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate VI850) GN=gag-pol PE=3 SV=3 | 65 | 208 | 2.0E-09 |
| sp|Q94C69|CSP3_ARATH | Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 | 52 | 197 | 6.0E-09 |
| sp|P20875|POL_HV1JR | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate JRCSF) GN=gag-pol PE=1 SV=3 | 80 | 208 | 1.0E-08 |
| sp|Q8N567|ZCHC9_HUMAN | Zinc finger CCHC domain-containing protein 9 OS=Homo sapiens GN=ZCCHC9 PE=2 SV=2 | 53 | 202 | 1.0E-08 |
| sp|Q9QBZ9|POL_HV197 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 97ZR-EQTB11) GN=gag-pol PE=3 SV=2 | 80 | 197 | 1.0E-08 |
| sp|P12499|POL_HV1Z2 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate Z2/CDC-Z34) GN=gag-pol PE=1 SV=3 | 80 | 208 | 2.0E-08 |
| sp|Q966L9|GLH2_CAEEL | ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 | 9 | 99 | 3.0E-08 |
| sp|Q9Q720|POL_HV1V9 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate VI991) GN=gag-pol PE=3 SV=3 | 80 | 208 | 3.0E-08 |
| sp|Q9QBZ1|POL_HV1M2 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP257) GN=gag-pol PE=3 SV=3 | 130 | 197 | 4.0E-08 |
| sp|O12158|POL_HV192 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate 92BR025) GN=gag-pol PE=1 SV=2 | 130 | 197 | 4.0E-08 |
| sp|P03367|POL_HV1BR | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) GN=gag-pol PE=1 SV=3 | 80 | 197 | 4.0E-08 |
| sp|Q8R1J3|ZCHC9_MOUSE | Zinc finger CCHC domain-containing protein 9 OS=Mus musculus GN=Zcchc9 PE=2 SV=2 | 53 | 225 | 4.0E-08 |
| sp|Q9QBY3|POL_HV196 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 96CM-MP535) GN=gag-pol PE=3 SV=3 | 130 | 197 | 4.0E-08 |
| sp|Q9QBZ5|POL_HV1MP | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP255) GN=gag-pol PE=3 SV=3 | 80 | 208 | 5.0E-08 |
| sp|P0C6F2|POL_HV1LW | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate LW123) GN=gag-pol PE=1 SV=1 | 80 | 197 | 5.0E-08 |
| sp|P04587|POL_HV1B5 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH5) GN=gag-pol PE=1 SV=3 | 130 | 197 | 6.0E-08 |
| sp|O76743|GLH4_CAEEL | ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 | 27 | 163 | 6.0E-08 |
| sp|Q73368|POL_HV1B9 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (strain 89.6) GN=gag-pol PE=3 SV=3 | 80 | 197 | 8.0E-08 |
| sp|P04588|POL_HV1MA | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate MAL) GN=gag-pol PE=1 SV=3 | 80 | 208 | 8.0E-08 |
| sp|P35963|POL_HV1Y2 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) GN=gag-pol PE=1 SV=3 | 80 | 197 | 8.0E-08 |
| sp|Q966L9|GLH2_CAEEL | ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 | 29 | 194 | 1.0E-07 |
| sp|P04587|POL_HV1B5 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH5) GN=gag-pol PE=1 SV=3 | 80 | 164 | 1.0E-07 |
| sp|P03366|POL_HV1B1 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) GN=gag-pol PE=1 SV=3 | 80 | 164 | 1.0E-07 |
| sp|P20892|POL_HV1OY | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate OYI) GN=gag-pol PE=3 SV=3 | 130 | 197 | 1.0E-07 |
| sp|Q9WC63|POL_HV1S9 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9173) GN=gag-pol PE=3 SV=3 | 130 | 197 | 1.0E-07 |
| sp|O89940|POL_HV1SE | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate SE6165) GN=gag-pol PE=3 SV=3 | 130 | 197 | 1.0E-07 |
| sp|O89940|POL_HV1SE | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate SE6165) GN=gag-pol PE=3 SV=3 | 80 | 195 | 1.0E-07 |
| sp|Q9WC54|POL_HV1S2 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9280) GN=gag-pol PE=3 SV=3 | 130 | 197 | 1.0E-07 |
| sp|Q75002|POL_HV1ET | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate ETH2220) GN=gag-pol PE=3 SV=3 | 130 | 197 | 1.0E-07 |
| sp|Q8AII1|POL_SIVTN | Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate TAN1) GN=gag-pol PE=3 SV=4 | 80 | 195 | 1.0E-07 |
| sp|P12451|POL_HV2SB | Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate SBLISY) GN=gag-pol PE=3 SV=3 | 135 | 194 | 1.0E-07 |
| sp|P12497|POL_HV1N5 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate NY5) GN=gag-pol PE=1 SV=4 | 80 | 208 | 2.0E-07 |
| sp|P24736|GAG_HV1U4 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate U455) GN=gag PE=1 SV=3 | 80 | 174 | 2.0E-07 |
| sp|P03369|POL_HV1A2 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2) GN=gag-pol PE=1 SV=3 | 80 | 208 | 2.0E-07 |
| sp|P04585|POL_HV1H2 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) GN=gag-pol PE=1 SV=4 | 80 | 197 | 2.0E-07 |
| sp|P04589|POL_HV1EL | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate ELI) GN=gag-pol PE=3 SV=3 | 130 | 197 | 2.0E-07 |
| sp|P18802|POL_HV1ND | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate NDK) GN=gag-pol PE=3 SV=3 | 80 | 197 | 2.0E-07 |
| sp|Q8AII2|GAG_SIVTN | Gag polyprotein OS=Simian immunodeficiency virus (isolate TAN1) GN=gag PE=3 SV=3 | 80 | 223 | 2.0E-07 |
| sp|Q65XV7|RFA1C_ORYSJ | Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 | 9 | 67 | 3.0E-07 |
| sp|O93215|POL_HV190 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate 90CF056) GN=gag-pol PE=3 SV=4 | 130 | 194 | 3.0E-07 |
| sp|P05961|POL_HV1MN | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate MN) GN=gag-pol PE=1 SV=3 | 80 | 197 | 3.0E-07 |
| sp|Q82851|POL_JEMBR | Gag-Pol polyprotein OS=Jembrana disease virus GN=gag-pol PE=3 SV=1 | 96 | 167 | 3.0E-07 |
| sp|O12158|POL_HV192 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate 92BR025) GN=gag-pol PE=1 SV=2 | 80 | 208 | 4.0E-07 |
| sp|Q75002|POL_HV1ET | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate ETH2220) GN=gag-pol PE=3 SV=3 | 80 | 202 | 4.0E-07 |
| sp|P34689|GLH1_CAEEL | ATP-dependent RNA helicase glh-1 OS=Caenorhabditis elegans GN=glh-1 PE=1 SV=3 | 9 | 99 | 4.0E-07 |
| sp|P05959|POL_HV1RH | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate RF/HAT3) GN=gag-pol PE=1 SV=3 | 130 | 191 | 4.0E-07 |
| sp|P04584|POL_HV2RO | Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) GN=gag-pol PE=1 SV=3 | 135 | 194 | 4.0E-07 |
| sp|Q9QBZ1|POL_HV1M2 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP257) GN=gag-pol PE=3 SV=3 | 80 | 216 | 5.0E-07 |
| sp|P04589|POL_HV1EL | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate ELI) GN=gag-pol PE=3 SV=3 | 80 | 208 | 5.0E-07 |
| sp|O76743|GLH4_CAEEL | ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 | 7 | 95 | 6.0E-07 |
| sp|Q9WC63|POL_HV1S9 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9173) GN=gag-pol PE=3 SV=3 | 80 | 164 | 6.0E-07 |
| sp|O89290|POL_HV193 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate 93BR020) GN=gag-pol PE=3 SV=3 | 130 | 194 | 6.0E-07 |
| sp|Q9WC54|POL_HV1S2 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9280) GN=gag-pol PE=3 SV=3 | 80 | 164 | 7.0E-07 |
| sp|P05960|POL_HV1C4 | Gag-Pol polyprotein (Fragment) OS=Human immunodeficiency virus type 1 group M subtype B (isolate CDC-451) GN=gag-pol PE=3 SV=3 | 80 | 208 | 7.0E-07 |
| sp|P17757|POL_HV2D1 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate D194) GN=gag-pol PE=3 SV=3 | 135 | 194 | 7.0E-07 |
| sp|P36627|BYR3_SCHPO | Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 | 9 | 97 | 8.0E-07 |
| sp|Q9QBY3|POL_HV196 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 96CM-MP535) GN=gag-pol PE=3 SV=3 | 80 | 208 | 8.0E-07 |
| sp|O93215|POL_HV190 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate 90CF056) GN=gag-pol PE=3 SV=4 | 80 | 164 | 9.0E-07 |
| sp|Q02836|POL_SIVG1 | Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.grivet (isolate AGM gr-1) GN=gag-pol PE=3 SV=2 | 124 | 163 | 9.0E-07 |
| sp|Q82851|POL_JEMBR | Gag-Pol polyprotein OS=Jembrana disease virus GN=gag-pol PE=3 SV=1 | 145 | 195 | 1.0E-06 |
| sp|P19505|POL_SIVSP | Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate PBj14/BCL-3) GN=gag-pol PE=1 SV=2 | 92 | 194 | 1.0E-06 |
| sp|Q74120|POL_HV2KR | Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate KR) GN=gag-pol PE=3 SV=3 | 144 | 217 | 1.0E-06 |
| sp|Q82850|GAG_JEMBR | Gag polyprotein OS=Jembrana disease virus GN=gag PE=3 SV=1 | 91 | 168 | 1.0E-06 |
| sp|P24107|POL_HV2CA | Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate CAM2) GN=gag-pol PE=3 SV=3 | 136 | 194 | 1.0E-06 |
| sp|Q1A267|POL_SIVMB | Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate MB66) GN=gag-pol PE=3 SV=4 | 119 | 191 | 1.0E-06 |
| sp|P20876|POL_HV2ST | Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ST) GN=gag-pol PE=3 SV=3 | 144 | 217 | 1.0E-06 |
| sp|Q9QC00|GAG_HV197 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 97ZR-EQTB11) GN=gag PE=3 SV=2 | 80 | 197 | 1.0E-06 |
| sp|P53849|GIS2_YEAST | Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 | 2 | 94 | 2.0E-06 |
| sp|Q8R1J3|ZCHC9_MOUSE | Zinc finger CCHC domain-containing protein 9 OS=Mus musculus GN=Zcchc9 PE=2 SV=2 | 28 | 144 | 2.0E-06 |
| sp|P05959|POL_HV1RH | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate RF/HAT3) GN=gag-pol PE=1 SV=3 | 80 | 208 | 2.0E-06 |
| sp|Q02836|POL_SIVG1 | Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.grivet (isolate AGM gr-1) GN=gag-pol PE=3 SV=2 | 148 | 197 | 2.0E-06 |
| sp|P05888|GAG_HV1MN | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate MN) GN=gag PE=1 SV=3 | 80 | 178 | 2.0E-06 |
| sp|P17283|POL_SIVCZ | Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate CPZ GAB1) GN=gag-pol PE=3 SV=2 | 130 | 197 | 2.0E-06 |
| sp|Q1A249|POL_SIVEK | Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate EK505) GN=gag-pol PE=3 SV=3 | 80 | 163 | 2.0E-06 |
| sp|P20892|POL_HV1OY | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate OYI) GN=gag-pol PE=3 SV=3 | 80 | 208 | 3.0E-06 |
| sp|Q9IDV9|POL_HV1YB | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group N (isolate YBF106) GN=gag-pol PE=1 SV=3 | 130 | 191 | 3.0E-06 |
| sp|P05887|GAG_HV1C4 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate CDC-451) GN=gag PE=3 SV=3 | 80 | 197 | 3.0E-06 |
| sp|P18042|POL_HV2G1 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate Ghana-1) GN=gag-pol PE=1 SV=4 | 136 | 194 | 3.0E-06 |
| sp|Q9QBZ6|GAG_HV1MP | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP255) GN=gag PE=3 SV=2 | 80 | 174 | 3.0E-06 |
| sp|P04593|GAG_HV1B5 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH5) GN=gag PE=3 SV=3 | 80 | 174 | 3.0E-06 |
| sp|P12498|POL_HV1J3 | Gag-Pol polyprotein (Fragment) OS=Human immunodeficiency virus type 1 group M subtype B (isolate JH32) GN=gag-pol PE=3 SV=4 | 80 | 208 | 3.0E-06 |
| sp|P17283|POL_SIVCZ | Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate CPZ GAB1) GN=gag-pol PE=3 SV=2 | 80 | 165 | 4.0E-06 |
| sp|Q9QSR4|GAG_HV1VI | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate VI850) GN=gag PE=3 SV=3 | 65 | 174 | 4.0E-06 |
| sp|Q70622|GAG_HV1LW | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate LW123) GN=gag PE=1 SV=3 | 80 | 197 | 4.0E-06 |
| sp|O41798|POL_HV19N | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate 92NG083) GN=gag-pol PE=3 SV=3 | 118 | 208 | 4.0E-06 |
| sp|P34689|GLH1_CAEEL | ATP-dependent RNA helicase glh-1 OS=Caenorhabditis elegans GN=glh-1 PE=1 SV=3 | 29 | 166 | 5.0E-06 |
| sp|P03347|GAG_HV1B1 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) GN=gag PE=1 SV=3 | 80 | 174 | 5.0E-06 |
| sp|P03348|GAG_HV1BR | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) GN=gag PE=1 SV=3 | 80 | 197 | 5.0E-06 |
| sp|O89290|POL_HV193 | Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate 93BR020) GN=gag-pol PE=3 SV=3 | 80 | 164 | 6.0E-06 |
| sp|Q1A267|POL_SIVMB | Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate MB66) GN=gag-pol PE=3 SV=4 | 84 | 208 | 6.0E-06 |
| sp|Q9QSR4|GAG_HV1VI | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate VI850) GN=gag PE=3 SV=3 | 130 | 197 | 6.0E-06 |
| sp|Q966L9|GLH2_CAEEL | ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 | 46 | 192 | 7.0E-06 |
| sp|Q9QBZ6|GAG_HV1MP | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP255) GN=gag PE=3 SV=2 | 144 | 197 | 7.0E-06 |
| sp|P04593|GAG_HV1B5 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH5) GN=gag PE=3 SV=3 | 144 | 197 | 7.0E-06 |
| sp|P18096|POL_HV2BE | Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate BEN) GN=gag-pol PE=3 SV=4 | 136 | 217 | 7.0E-06 |
| sp|P12494|GAG_HV1J3 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate JH32) GN=gag PE=3 SV=3 | 80 | 178 | 8.0E-06 |
| sp|P35962|GAG_HV1Y2 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) GN=gag PE=1 SV=2 | 80 | 197 | 8.0E-06 |
| sp|Q73367|GAG_HV1B9 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (strain 89.6) GN=gag PE=3 SV=3 | 80 | 197 | 8.0E-06 |
| sp|Q9QBZ2|GAG_HV1M2 | Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP257) GN=gag PE=3 SV=2 | 130 | 197 | 1.0E-05 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0008270 | zinc ion binding | Yes |
| GO:0003676 | nucleic acid binding | Yes |
| GO:0097159 | organic cyclic compound binding | No |
| GO:0046872 | metal ion binding | No |
| GO:0046914 | transition metal ion binding | No |
| GO:0005488 | binding | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0043167 | ion binding | No |
| GO:0043169 | cation binding | No |
| GO:0003674 | molecular_function | No |
| Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
|---|---|---|---|---|---|---|---|---|---|---|---|
| Cytoplasm | Nuclear localization signal | 0.5373 | 0.4677 | 0.111 | 0.0558 | 0.1616 | 0.0042 | 0.0947 | 0.1124 | 0.0688 | 0.0001 |
| Transcription Factor Class (based on PFAM domains) |
|---|
| Zinc finger, CCHC-type |
| Orthofinder run ID | 4 |
| Orthogroup | 4335 |
| Change Orthofinder run |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|8906 MSSLSRRACYKCGNVGHYAEVCSSAERLCYNCKQPGHESNSCPLPRTTEAKQCYHCQGLGHVQADCPTLRLSGTP TGGRCYNCGQPGHLARACPNPVGPMGRGAPPMARGGYAPGFARGAFPGGPRPATCYKCGGPNHFARDCQAQAMKC YACGKLGHISRDCTAPNGGPLNTVGKTCYQCGEAGHISRDCPQKNPNGEMPTDVEMQVGAVPAAPAPVAPIAPVA * |
| Coding | >Hirsu2|8906 ATGTCCTCACTCTCCCGCCGCGCCTGCTACAAATGCGGCAACGTTGGCCATTACGCCGAGGTGTGCTCCTCTGCC GAGCGGCTCTGCTACAACTGCAAGCAGCCGGGCCACGAGTCCAACAGCTGTCCCCTGCCCCGCACGACCGAGGCC AAGCAATGCTACCACTGCCAGGGCCTCGGCCACGTCCAGGCTGATTGCCCGACGCTGCGCTTGAGCGGGACCCCC ACGGGCGGGCGCTGCTACAACTGCGGCCAGCCCGGCCACCTCGCTCGCGCATGCCCCAACCCCGTGGGCCCCATG GGTCGCGGCGCCCCCCCCATGGCCCGCGGCGGATACGCCCCTGGCTTCGCCCGCGGCGCCTTTCCCGGCGGCCCT CGCCCGGCGACCTGCTACAAATGCGGCGGGCCCAACCACTTTGCCCGTGATTGCCAGGCGCAAGCGATGAAGTGC TACGCCTGCGGCAAGCTGGGCCACATCTCGCGCGACTGCACCGCCCCGAACGGCGGCCCCCTGAACACGGTGGGC AAGACTTGCTACCAATGTGGCGAGGCTGGCCACATCTCGAGGGATTGCCCACAGAAGAATCCCAACGGCGAGATG CCCACTGACGTCGAGATGCAGGTCGGCGCCGTCCCGGCCGCCCCCGCCCCCGTGGCGCCCATTGCCCCAGTGGCA TAG |
| Transcript | >Hirsu2|8906 ATGTCCTCACTCTCCCGCCGCGCCTGCTACAAATGCGGCAACGTTGGCCATTACGCCGAGGTGTGCTCCTCTGCC GAGCGGCTCTGCTACAACTGCAAGCAGCCGGGCCACGAGTCCAACAGCTGTCCCCTGCCCCGCACGACCGAGGCC AAGCAATGCTACCACTGCCAGGGCCTCGGCCACGTCCAGGCTGATTGCCCGACGCTGCGCTTGAGCGGGACCCCC ACGGGCGGGCGCTGCTACAACTGCGGCCAGCCCGGCCACCTCGCTCGCGCATGCCCCAACCCCGTGGGCCCCATG GGTCGCGGCGCCCCCCCCATGGCCCGCGGCGGATACGCCCCTGGCTTCGCCCGCGGCGCCTTTCCCGGCGGCCCT CGCCCGGCGACCTGCTACAAATGCGGCGGGCCCAACCACTTTGCCCGTGATTGCCAGGCGCAAGCGATGAAGTGC TACGCCTGCGGCAAGCTGGGCCACATCTCGCGCGACTGCACCGCCCCGAACGGCGGCCCCCTGAACACGGTGGGC AAGACTTGCTACCAATGTGGCGAGGCTGGCCACATCTCGAGGGATTGCCCACAGAAGAATCCCAACGGCGAGATG CCCACTGACGTCGAGATGCAGGTCGGCGCCGTCCCGGCCGCCCCCGCCCCCGTGGCGCCCATTGCCCCAGTGGCA TAG |
| Gene | >Hirsu2|8906 ATGTCCTCACTCTCCCGCCGCGCCTGCTACAAATGCGGCAACGTTGGCCATTACGCCGAGGTGTGCTCCTCTGCC GAGCGGCTCTGCTACAACTGTACGTCTCCCCCCCGCTGCGACGCCGCCCGGCCTGTCCCCCGGCCGTCCGTACGC CGACTAACCTCGTCCCTCCAGGCAAGCAGCCGGGCCACGAGTCCAACAGCTGTCCCCTGCCCCGCACGACCGAGG CCAAGCAATGCTACCACTGCCAGGGCCTCGGCCACGTCCAGGCTGATTGCCCGACGCTGCGCTTGAGCGGGACCC CCACGGGCGGGCGCTGCTACAACTGCGGCCAGCCCGGCCACCTCGCTGTACGTCCTTGTCGGCACCGCCCTTACC GCGCCGCCCCCTTGACTGACGGCCTGTGCACAGCGCGCATGCCCCAACCCCGTGGGCCCCATGGGTCGCGGCGCC CCCCCCATGGCCCGCGGCGGATACGCCCCTGGCTTCGCCCGCGGCGCCTTTCCCGGCGGCCCTCGCCCGGCGACC TGCTACAAATGCGGCGGGCCCAACCACTTTGCCCGTGATTGCCAGGCGCAAGCGATGAAGTGCTACGCCTGCGGC AAGCTGGGCCACATCTCGCGCGACTGCACCGCCCCGAACGGCGGCCCCCTGAACACGGTGGGCAAGACTTGCTAC CAATGTGGCGAGGCTGGCCACATCTCGAGGGATTGCCCACAGAAGAATCCCAACGGCGAGATGCCCACTGACGTC GAGATGCAGGTCGGCGCCGTCCCGGCCGCCCCCGCCCCCGTGGCGCCCATTGCCCCAGTGGCATAG |