Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8900
Gene name
LocationContig_61:25200..27480
Strand-
Gene length (bp)2280
Transcript length (bp)2112
Coding sequence length (bp)2112
Protein length (aa) 704

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00668 Condensation Condensation domain 9.7E-08 367 571
PF00550 PP-binding Phosphopantetheine attachment site 6.4E-11 180 242

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 176 549 2.0E-24
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1 547 5.0E-21
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 188 552 5.0E-18
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1 549 7.0E-17
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1 599 8.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 176 549 2.0E-24
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1 547 5.0E-21
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 188 552 5.0E-18
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1 549 7.0E-17
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1 599 8.0E-17
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 178 584 1.0E-15
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 181 568 1.0E-14
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 174 416 4.0E-14
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 188 566 2.0E-12
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 48 551 1.0E-10
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 206 590 1.0E-09
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 178 550 2.0E-09
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 176 553 3.0E-09
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 191 551 4.0E-09
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 189 419 7.0E-09
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 188 565 1.0E-08
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 188 565 1.0E-08
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 283 567 2.0E-08
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 176 549 3.0E-08
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 168 572 5.0E-08
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 162 566 8.0E-08
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 180 469 9.0E-08
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 275 566 5.0E-07
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 277 604 4.0E-06
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 189 554 6.0E-06
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 185 344 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8900
MNTVAMRCILHGSVSGFLKYVEETIADVRYHQHFPLRKAHAAAKSGSSKMFNSLFLLQRSPEQGASFSPLLWSVG
GESAVEYPVCVEAEPIDGGLIWRVACQAQLFSRGETETLINQLEQVLKFILERETAEVLSFHGEDVSICGMPAVA
IREAAPIQGSPEATLGLQDEADNWRETDSAIRDAVCHVLGVPPESIKPWSNLHQLGLDSISAIKVSVLLRKRRVH
LKPRELVDSPSLEDMARSARLGHETEEQLSRTDSQWMPPRDIDAGSLLAEHGLGQDAVEAILPASPMQAYMLTAW
QNSCGSLFFPEFRFRVEGPVDTLQARKAWLALLGKMPILRTRFIATGSKEVPWIQMIAKEDAVHSGLVSQPLVNF
RVVEGASGEGLTIRLRIHHALYDGFSLPALMRRLGDLLIGDWGSKSNGILHWARHCIGLPMARVERREFWTKYLR
GGAPISVPPTLSEETKGTTTSYLDVSAINDVAPLRAVALRHAISLQSLVLAALATSIGGQDACSGEKAVVLGIYL
ASRAEGQDSPLAVYPTLNLVPLKVQLGRGCSAITLARGIQEDIHSMGIAGRADVGLWEILAWTGMKIDCFINFLA
EPPVEAASADPEPVTLTPIREEVGEGDAADGELSASTSRAAWEEPWLQKNSIRDAIQLSVDIEAAVHGQGLALGV
FGPHGRVSNEWAAKLVADTAAFLGDVAG*
Coding >Hirsu2|8900
ATGAATACCGTGGCCATGCGATGCATTCTGCATGGCTCAGTCTCCGGCTTTCTCAAGTATGTGGAAGAGACGATT
GCGGACGTGCGCTACCACCAACATTTTCCCCTGCGCAAGGCCCATGCTGCCGCAAAGTCGGGATCGTCGAAAATG
TTCAATTCGCTCTTCCTTCTGCAGAGGTCGCCTGAACAGGGTGCTTCATTCAGCCCGCTGCTCTGGTCGGTAGGA
GGCGAATCGGCTGTGGAATATCCAGTTTGCGTCGAGGCCGAGCCGATCGACGGTGGGTTGATTTGGCGCGTTGCC
TGCCAGGCGCAGCTATTCAGCAGGGGCGAGACGGAGACTTTGATCAATCAGCTGGAGCAGGTTCTCAAGTTCATT
CTCGAGCGTGAGACAGCGGAAGTCCTATCGTTCCACGGCGAAGATGTGTCTATTTGCGGGATGCCCGCCGTGGCG
ATCAGAGAAGCCGCACCCATCCAAGGCAGCCCCGAGGCCACGCTCGGTCTGCAGGACGAAGCCGATAACTGGCGA
GAGACGGATTCTGCCATCCGCGACGCTGTGTGCCATGTTTTGGGTGTGCCTCCCGAATCCATCAAGCCATGGTCC
AACCTACATCAACTCGGCCTTGACTCCATCAGCGCGATCAAGGTGTCGGTGCTGCTGCGCAAGAGAAGAGTTCAC
TTGAAACCAAGGGAGCTGGTCGACTCACCCAGTCTGGAAGACATGGCGCGTAGCGCCAGGCTCGGCCACGAAACC
GAGGAGCAGCTGTCTCGAACAGACAGCCAATGGATGCCGCCGCGCGACATCGATGCCGGCAGTCTACTAGCAGAA
CACGGCCTCGGACAAGATGCTGTCGAGGCCATCCTGCCAGCCTCGCCGATGCAGGCATACATGCTGACCGCGTGG
CAGAACTCTTGCGGCTCCCTGTTCTTCCCGGAGTTCCGTTTCCGGGTCGAGGGCCCCGTCGACACGTTGCAGGCC
CGTAAAGCATGGCTGGCCCTCCTCGGCAAGATGCCGATCCTGCGGACGCGCTTCATAGCCACCGGATCCAAGGAG
GTGCCGTGGATACAGATGATTGCCAAGGAAGACGCCGTTCATTCAGGTCTCGTCTCTCAGCCGCTAGTCAACTTC
CGCGTGGTCGAAGGCGCGTCCGGAGAGGGCTTGACGATTCGGCTGCGAATACACCACGCCCTGTACGACGGGTTC
AGTCTCCCGGCCTTGATGCGCCGGCTTGGCGATCTATTGATCGGCGACTGGGGCAGCAAAAGCAACGGGATCCTT
CACTGGGCCCGCCACTGCATTGGCCTGCCCATGGCTCGGGTTGAGCGACGCGAATTCTGGACGAAATACCTTCGA
GGGGGTGCCCCCATCAGTGTGCCGCCGACCTTGAGCGAGGAAACAAAGGGGACGACAACATCATACCTCGACGTC
TCAGCCATCAATGATGTCGCGCCGCTCCGGGCAGTGGCATTGCGGCACGCCATCAGCTTGCAATCGCTCGTGCTG
GCAGCGCTGGCGACCAGTATCGGGGGGCAGGATGCCTGCTCTGGCGAGAAGGCTGTCGTCTTGGGCATCTATCTG
GCCAGCCGAGCGGAAGGCCAAGACTCGCCGCTGGCCGTCTATCCGACGCTCAATCTGGTGCCTCTCAAGGTCCAG
CTCGGCCGCGGCTGCAGCGCGATTACCCTGGCCCGAGGCATCCAGGAAGACATCCACAGCATGGGCATTGCCGGG
CGAGCTGACGTGGGCCTTTGGGAGATCCTGGCTTGGACAGGGATGAAGATCGATTGCTTCATCAACTTTCTCGCC
GAGCCCCCGGTAGAGGCGGCCTCGGCCGACCCGGAGCCTGTCACCTTGACCCCCATACGGGAGGAAGTGGGCGAA
GGCGATGCAGCCGATGGCGAACTGTCCGCGTCGACGTCGAGGGCGGCTTGGGAAGAGCCTTGGCTGCAAAAGAAC
TCTATTCGAGACGCCATTCAGCTCTCGGTGGACATCGAAGCCGCCGTTCACGGCCAGGGTCTGGCCCTTGGCGTT
TTTGGACCGCACGGCCGCGTGTCGAACGAGTGGGCCGCCAAGCTCGTCGCCGACACGGCGGCATTCCTCGGCGAT
GTTGCTGGTTGA
Transcript >Hirsu2|8900
ATGAATACCGTGGCCATGCGATGCATTCTGCATGGCTCAGTCTCCGGCTTTCTCAAGTATGTGGAAGAGACGATT
GCGGACGTGCGCTACCACCAACATTTTCCCCTGCGCAAGGCCCATGCTGCCGCAAAGTCGGGATCGTCGAAAATG
TTCAATTCGCTCTTCCTTCTGCAGAGGTCGCCTGAACAGGGTGCTTCATTCAGCCCGCTGCTCTGGTCGGTAGGA
GGCGAATCGGCTGTGGAATATCCAGTTTGCGTCGAGGCCGAGCCGATCGACGGTGGGTTGATTTGGCGCGTTGCC
TGCCAGGCGCAGCTATTCAGCAGGGGCGAGACGGAGACTTTGATCAATCAGCTGGAGCAGGTTCTCAAGTTCATT
CTCGAGCGTGAGACAGCGGAAGTCCTATCGTTCCACGGCGAAGATGTGTCTATTTGCGGGATGCCCGCCGTGGCG
ATCAGAGAAGCCGCACCCATCCAAGGCAGCCCCGAGGCCACGCTCGGTCTGCAGGACGAAGCCGATAACTGGCGA
GAGACGGATTCTGCCATCCGCGACGCTGTGTGCCATGTTTTGGGTGTGCCTCCCGAATCCATCAAGCCATGGTCC
AACCTACATCAACTCGGCCTTGACTCCATCAGCGCGATCAAGGTGTCGGTGCTGCTGCGCAAGAGAAGAGTTCAC
TTGAAACCAAGGGAGCTGGTCGACTCACCCAGTCTGGAAGACATGGCGCGTAGCGCCAGGCTCGGCCACGAAACC
GAGGAGCAGCTGTCTCGAACAGACAGCCAATGGATGCCGCCGCGCGACATCGATGCCGGCAGTCTACTAGCAGAA
CACGGCCTCGGACAAGATGCTGTCGAGGCCATCCTGCCAGCCTCGCCGATGCAGGCATACATGCTGACCGCGTGG
CAGAACTCTTGCGGCTCCCTGTTCTTCCCGGAGTTCCGTTTCCGGGTCGAGGGCCCCGTCGACACGTTGCAGGCC
CGTAAAGCATGGCTGGCCCTCCTCGGCAAGATGCCGATCCTGCGGACGCGCTTCATAGCCACCGGATCCAAGGAG
GTGCCGTGGATACAGATGATTGCCAAGGAAGACGCCGTTCATTCAGGTCTCGTCTCTCAGCCGCTAGTCAACTTC
CGCGTGGTCGAAGGCGCGTCCGGAGAGGGCTTGACGATTCGGCTGCGAATACACCACGCCCTGTACGACGGGTTC
AGTCTCCCGGCCTTGATGCGCCGGCTTGGCGATCTATTGATCGGCGACTGGGGCAGCAAAAGCAACGGGATCCTT
CACTGGGCCCGCCACTGCATTGGCCTGCCCATGGCTCGGGTTGAGCGACGCGAATTCTGGACGAAATACCTTCGA
GGGGGTGCCCCCATCAGTGTGCCGCCGACCTTGAGCGAGGAAACAAAGGGGACGACAACATCATACCTCGACGTC
TCAGCCATCAATGATGTCGCGCCGCTCCGGGCAGTGGCATTGCGGCACGCCATCAGCTTGCAATCGCTCGTGCTG
GCAGCGCTGGCGACCAGTATCGGGGGGCAGGATGCCTGCTCTGGCGAGAAGGCTGTCGTCTTGGGCATCTATCTG
GCCAGCCGAGCGGAAGGCCAAGACTCGCCGCTGGCCGTCTATCCGACGCTCAATCTGGTGCCTCTCAAGGTCCAG
CTCGGCCGCGGCTGCAGCGCGATTACCCTGGCCCGAGGCATCCAGGAAGACATCCACAGCATGGGCATTGCCGGG
CGAGCTGACGTGGGCCTTTGGGAGATCCTGGCTTGGACAGGGATGAAGATCGATTGCTTCATCAACTTTCTCGCC
GAGCCCCCGGTAGAGGCGGCCTCGGCCGACCCGGAGCCTGTCACCTTGACCCCCATACGGGAGGAAGTGGGCGAA
GGCGATGCAGCCGATGGCGAACTGTCCGCGTCGACGTCGAGGGCGGCTTGGGAAGAGCCTTGGCTGCAAAAGAAC
TCTATTCGAGACGCCATTCAGCTCTCGGTGGACATCGAAGCCGCCGTTCACGGCCAGGGTCTGGCCCTTGGCGTT
TTTGGACCGCACGGCCGCGTGTCGAACGAGTGGGCCGCCAAGCTCGTCGCCGACACGGCGGCATTCCTCGGCGAT
GTTGCTGGTTGA
Gene >Hirsu2|8900
ATGAATACCGTGGCCATGCGATGCATTCTGCATGGCTCAGTCTCCGGCTTTCTCAAGTATGTGGAAGAGACGATT
GCGGACGTGCGCTACCACCAACATTTTCCCCTGCGCAAGGCCCATGCTGCCGCAAAGTCGGGATCGTCGAAAATG
TTCAATTCGCTCTTCCTTCTGCAGAGGTCGCCTGAACAGGGTGCTTCATTCAGCCCGCTGCTCTGGTCGGTAGGA
GGCGAATCGGCTGTGGAATATCCAGTTTGCGTCGAGGCCGAGCCGATCGACGGTGGGTTGATTTGGCGCGTTGCC
TGCCAGGCGCAGCTATTCAGCAGGGGCGAGACGGAGACTTTGATCAATCAGCTGGAGCAGGTTCTCAAGTTCATT
CTCGAGCGTGAGACAGCGGAAGTCCTATCGTTCCACGGCGAAGATGTGTCTATTTGCGGGATGCCCGCCGTGGCG
ATCAGAGAAGCCGCACCCATCCAAGGCAGCCCCGAGGCCACGCTCGGTCTGCAGGACGAAGCCGATAACTGGCGA
GAGACGGATTCTGCCATCCGCGACGCTGTGTGCCATGTTTTGGGTGTGCCTCCCGAATCCATCAAGCCATGGTCC
AACCTACATCAACTCGGCCTTGACTCCATCAGCGCGATCAAGGTGTCGGTGCTGCTGCGCAAGAGAAGAGTTCAC
TTGAAACCAAGGGAGCTGGTCGACTCACCCAGTCTGGAAGACATGGCGCGTAGCGCCAGGCTCGGCCACGAAACC
GAGGAGCAGCTGTCTCGAACAGACAGCCAATGGATGCCGCCGCGCGACATCGATGCCGGCAGTCTACTAGCAGAA
CACGGCCTCGGACAAGATGCTGTCGAGGCCATCCTGCCAGCCTCGCCGATGCAGGCATACATGCTGACCGCGTGG
CAGAACTCTTGCGGCTCCCTGTTCTTCCCGGAGTTCCGTTTCCGGGTCGAGGGCCCCGTCGACACGTTGCAGGCC
CGTAAAGCATGGCTGGCCCTCCTCGGCAAGATGCCGATCCTGCGGACGCGCTTCATAGCCACCGGATCCAAGGAG
GTGCCGTGGATACAGATGATTGCCAAGGAAGACGCCGTTCATTCAGGTCTCGTCTCTCAGCCGCTAGTCAACTTC
CGCGTGGTCGAAGGCGCGTCCGGAGAGGGCTTGACGATTCGGCTGCGAATACACCACGCCCTGTACGACGGGTTC
AGTCTCCCGGCCTTGATGCGCCGGCTTGGCGATCTATTGATCGGCGACTGGGGCAGCAAAAGCAACGGGATCCTT
CACTGGGCCCGCCACTGCATTGGCCTGCCCATGGCTCGGGTTGAGCGACGCGAATTCTGGACGAAATACCTTCGA
GGGGGTGCCCCCATCAGTGTGCCGCCGACCTTGAGCGAGGAAACAAAGGGGACGACAACATCATACCTCGACGTC
TCAGCCATCAATGATGTCGCGCCGCTCCGGGCAGTGGCATTGCGGCACGCCATCAGCTTGCAATCGCTCGTGCTG
GCAGCGCTGGCGACCAGTATCGGGGGGCAGGATGCCTGCTCTGGCGAGAAGGCTGTCGTCTTGGGCATCTATCTG
GCCAGCCGAGCGGAAGGCCAAGACTCGCCGCTGGCCGTCTATCCGACGCTCAATCTGGTGCCTCTCAAGGTCCAG
CTCGGCCGCGGCTGCAGCGCGATTACCCTGGCCCGAGGCATCCAGGAAGACATCCACAGCATGGGCATTGCCGGG
CGAGCTGACGTGGGCCTTTGGGAGATCCTGGCTTGGACAGGGATGAAGATCGATTGCTTCATCAACTTTCTCGCC
GAGCCCCCGGTAGAGGCGGCCTCGGCCGACCCGGAGCCTGTCACCTTGACCCCCATACGGGAGGAAGTGGGCGAA
GGCGATGCAGCCGATGGCGAACTGTCCGCGTCGACGTCGAGGGCGGCTTGGGAAGAGCCTTGGCTGCAAAAGAAC
TCTATTCGAGACGCCATTCAGGTGAGTGATGACGTGTTCGTTGGCTACCTCCGTGAGCCGCATCTTCTACTCCGC
ACCTCTATCAATTCTCGTCGTGACGACTGCCCTCTTCCCTTTGCCGATTTCACCGGCGGAAAAATTAGGGGGCAG
CTCGCAGCATCGCTAACATAAGGTCCCGCAAAACCCTAGCTCTCGGTGGACATCGAAGCCGCCGTTCACGGCCAG
GGTCTGGCCCTTGGCGTTTTTGGACCGCACGGCCGCGTGTCGAACGAGTGGGCCGCCAAGCTCGTCGCCGACACG
GCGGCATTCCTCGGCGATGTTGCTGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail