Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|889
Gene name
LocationContig_1187:422..3461
Strand-
Gene length (bp)3039
Transcript length (bp)2973
Coding sequence length (bp)2973
Protein length (aa) 991

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 1.7E-28 110 248
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 6.9E-23 816 978

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87122|YDL6_SCHPO Putative cation exchanger C3A12.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A12.06c PE=3 SV=1 62 248 2.0E-47
sp|Q6J4K2|NCKX6_HUMAN Sodium/potassium/calcium exchanger 6, mitochondrial OS=Homo sapiens GN=SLC8B1 PE=1 SV=2 67 324 2.0E-34
sp|Q925Q3|NCKX6_MOUSE Sodium/potassium/calcium exchanger 6, mitochondrial OS=Mus musculus GN=Slc8b1 PE=2 SV=2 23 261 4.0E-34
sp|P87122|YDL6_SCHPO Putative cation exchanger C3A12.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A12.06c PE=3 SV=1 781 983 7.0E-34
sp|Q6AXS0|NCKX6_RAT Sodium/potassium/calcium exchanger 6, mitochondrial OS=Rattus norvegicus GN=Slc8b1 PE=1 SV=1 67 261 3.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87122|YDL6_SCHPO Putative cation exchanger C3A12.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A12.06c PE=3 SV=1 62 248 2.0E-47
sp|Q6J4K2|NCKX6_HUMAN Sodium/potassium/calcium exchanger 6, mitochondrial OS=Homo sapiens GN=SLC8B1 PE=1 SV=2 67 324 2.0E-34
sp|Q925Q3|NCKX6_MOUSE Sodium/potassium/calcium exchanger 6, mitochondrial OS=Mus musculus GN=Slc8b1 PE=2 SV=2 23 261 4.0E-34
sp|P87122|YDL6_SCHPO Putative cation exchanger C3A12.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A12.06c PE=3 SV=1 781 983 7.0E-34
sp|Q6AXS0|NCKX6_RAT Sodium/potassium/calcium exchanger 6, mitochondrial OS=Rattus norvegicus GN=Slc8b1 PE=1 SV=1 67 261 3.0E-33
sp|Q925Q3|NCKX6_MOUSE Sodium/potassium/calcium exchanger 6, mitochondrial OS=Mus musculus GN=Slc8b1 PE=2 SV=2 733 982 5.0E-33
sp|Q6AXS0|NCKX6_RAT Sodium/potassium/calcium exchanger 6, mitochondrial OS=Rattus norvegicus GN=Slc8b1 PE=1 SV=1 733 982 7.0E-33
sp|Q6J4K2|NCKX6_HUMAN Sodium/potassium/calcium exchanger 6, mitochondrial OS=Homo sapiens GN=SLC8B1 PE=1 SV=2 672 982 1.0E-31
sp|Q9SYG9|CCX4_ARATH Cation/calcium exchanger 4 OS=Arabidopsis thaliana GN=CCX4 PE=2 SV=1 62 309 2.0E-26
sp|Q9FKP1|CCX1_ARATH Cation/calcium exchanger 1 OS=Arabidopsis thaliana GN=CCX1 PE=2 SV=1 63 320 5.0E-26
sp|P34322|NCX7_CAEEL Putative sodium/calcium exchanger 7 OS=Caenorhabditis elegans GN=ncx-7 PE=3 SV=3 72 270 5.0E-26
sp|Q9LJI2|CCX3_ARATH Cation/calcium exchanger 3 OS=Arabidopsis thaliana GN=CCX3 PE=2 SV=1 61 308 2.0E-25
sp|P34315|NCX6_CAEEL Putative sodium/calcium exchanger 6 OS=Caenorhabditis elegans GN=ncx-6 PE=3 SV=3 72 270 5.0E-24
sp|Q12424|YD206_YEAST Putative cation exchanger YDL206W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDL206W PE=1 SV=1 792 982 1.0E-23
sp|P34322|NCX7_CAEEL Putative sodium/calcium exchanger 7 OS=Caenorhabditis elegans GN=ncx-7 PE=3 SV=3 704 985 4.0E-23
sp|P34315|NCX6_CAEEL Putative sodium/calcium exchanger 6 OS=Caenorhabditis elegans GN=ncx-6 PE=3 SV=3 743 971 1.0E-22
sp|O04034|CCX5_ARATH Cation/calcium exchanger 5 OS=Arabidopsis thaliana GN=CCX5 PE=2 SV=1 785 902 3.0E-20
sp|Q9SYG9|CCX4_ARATH Cation/calcium exchanger 4 OS=Arabidopsis thaliana GN=CCX4 PE=2 SV=1 734 972 5.0E-19
sp|Q12424|YD206_YEAST Putative cation exchanger YDL206W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDL206W PE=1 SV=1 116 269 2.0E-17
sp|Q9FKP1|CCX1_ARATH Cation/calcium exchanger 1 OS=Arabidopsis thaliana GN=CCX1 PE=2 SV=1 782 971 6.0E-17
sp|Q9FKP2|CCX2_ARATH Cation/calcium exchanger 2 OS=Arabidopsis thaliana GN=CCX2 PE=3 SV=1 56 250 7.0E-17
sp|Q9LJI2|CCX3_ARATH Cation/calcium exchanger 3 OS=Arabidopsis thaliana GN=CCX3 PE=2 SV=1 765 972 2.0E-15
sp|Q9UI40|NCKX2_HUMAN Sodium/potassium/calcium exchanger 2 OS=Homo sapiens GN=SLC24A2 PE=1 SV=1 677 981 9.0E-15
sp|O04034|CCX5_ARATH Cation/calcium exchanger 5 OS=Arabidopsis thaliana GN=CCX5 PE=2 SV=1 83 265 3.0E-14
sp|Q8NFF2|NCKX4_HUMAN Sodium/potassium/calcium exchanger 4 OS=Homo sapiens GN=SLC24A4 PE=1 SV=2 794 982 4.0E-14
sp|Q8CGQ8|NCKX4_MOUSE Sodium/potassium/calcium exchanger 4 OS=Mus musculus GN=Slc24a4 PE=2 SV=2 794 982 5.0E-14
sp|Q9IAL7|NCKX2_CHICK Sodium/potassium/calcium exchanger 2 OS=Gallus gallus GN=SLC24A2 PE=2 SV=1 807 981 3.0E-13
sp|O54701|NCKX2_RAT Sodium/potassium/calcium exchanger 2 OS=Rattus norvegicus GN=Slc24a2 PE=1 SV=1 787 981 4.0E-13
sp|Q9IAL7|NCKX2_CHICK Sodium/potassium/calcium exchanger 2 OS=Gallus gallus GN=SLC24A2 PE=2 SV=1 101 348 2.0E-12
sp|Q9HC58|NCKX3_HUMAN Sodium/potassium/calcium exchanger 3 OS=Homo sapiens GN=SLC24A3 PE=2 SV=4 797 982 3.0E-12
sp|Q99PD7|NCKX3_MOUSE Sodium/potassium/calcium exchanger 3 OS=Mus musculus GN=Slc24a3 PE=1 SV=3 797 982 8.0E-12
sp|Q9EPQ0|NCKX3_RAT Sodium/potassium/calcium exchanger 3 (Fragment) OS=Rattus norvegicus GN=Slc24a3 PE=1 SV=1 797 982 1.0E-11
sp|Q9QZM6|NCKX1_RAT Sodium/potassium/calcium exchanger 1 OS=Rattus norvegicus GN=Slc24a1 PE=2 SV=1 782 981 2.0E-11
sp|Q9UI40|NCKX2_HUMAN Sodium/potassium/calcium exchanger 2 OS=Homo sapiens GN=SLC24A2 PE=1 SV=1 101 246 3.0E-11
sp|Q8NFF2|NCKX4_HUMAN Sodium/potassium/calcium exchanger 4 OS=Homo sapiens GN=SLC24A4 PE=1 SV=2 115 273 3.0E-11
sp|O54701|NCKX2_RAT Sodium/potassium/calcium exchanger 2 OS=Rattus norvegicus GN=Slc24a2 PE=1 SV=1 101 246 3.0E-11
sp|Q9FKP2|CCX2_ARATH Cation/calcium exchanger 2 OS=Arabidopsis thaliana GN=CCX2 PE=3 SV=1 764 898 4.0E-11
sp|Q8CGQ8|NCKX4_MOUSE Sodium/potassium/calcium exchanger 4 OS=Mus musculus GN=Slc24a4 PE=2 SV=2 115 292 9.0E-11
sp|Q99PD7|NCKX3_MOUSE Sodium/potassium/calcium exchanger 3 OS=Mus musculus GN=Slc24a3 PE=1 SV=3 101 296 9.0E-11
sp|Q9HC58|NCKX3_HUMAN Sodium/potassium/calcium exchanger 3 OS=Homo sapiens GN=SLC24A3 PE=2 SV=4 101 296 2.0E-10
sp|Q9EPQ0|NCKX3_RAT Sodium/potassium/calcium exchanger 3 (Fragment) OS=Rattus norvegicus GN=Slc24a3 PE=1 SV=1 101 296 2.0E-10
sp|Q9IAL8|NCKX1_CHICK Sodium/potassium/calcium exchanger 1 OS=Gallus gallus GN=SLC24A1 PE=2 SV=1 812 981 4.0E-10
sp|P47144|ECM27_YEAST Protein ECM27 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM27 PE=1 SV=2 827 905 4.0E-10
sp|Q28139|NCKX1_BOVIN Sodium/potassium/calcium exchanger 1 OS=Bos taurus GN=SLC24A1 PE=1 SV=2 106 248 5.0E-10
sp|Q9IAL8|NCKX1_CHICK Sodium/potassium/calcium exchanger 1 OS=Gallus gallus GN=SLC24A1 PE=2 SV=1 106 263 7.0E-10
sp|O60721|NCKX1_HUMAN Sodium/potassium/calcium exchanger 1 OS=Homo sapiens GN=SLC24A1 PE=1 SV=1 798 981 7.0E-10
sp|Q28139|NCKX1_BOVIN Sodium/potassium/calcium exchanger 1 OS=Bos taurus GN=SLC24A1 PE=1 SV=2 798 981 8.0E-10
sp|O60721|NCKX1_HUMAN Sodium/potassium/calcium exchanger 1 OS=Homo sapiens GN=SLC24A1 PE=1 SV=1 106 269 1.0E-09
sp|Q8C261|NCKX5_MOUSE Sodium/potassium/calcium exchanger 5 OS=Mus musculus GN=Slc24a5 PE=2 SV=1 789 988 4.0E-09
sp|Q9QZM6|NCKX1_RAT Sodium/potassium/calcium exchanger 1 OS=Rattus norvegicus GN=Slc24a1 PE=2 SV=1 106 261 6.0E-09
sp|Q9U6A0|NCKX_DROME Sodium/potassium/calcium exchanger Nckx30C OS=Drosophila melanogaster GN=Nckx30C PE=2 SV=4 787 981 8.0E-09
sp|Q9U6A0|NCKX_DROME Sodium/potassium/calcium exchanger Nckx30C OS=Drosophila melanogaster GN=Nckx30C PE=2 SV=4 104 245 1.0E-08
sp|Q9VN12|NCKXH_DROME Probable sodium/potassium/calcium exchanger CG1090 OS=Drosophila melanogaster GN=CG1090 PE=2 SV=3 770 982 3.0E-08
sp|Q49SH1|NCKX5_DANRE Sodium/potassium/calcium exchanger 5 OS=Danio rerio GN=slc24a5 PE=2 SV=1 773 988 6.0E-08
sp|Q71RS6|NCKX5_HUMAN Sodium/potassium/calcium exchanger 5 OS=Homo sapiens GN=SLC24A5 PE=1 SV=1 773 988 5.0E-07
sp|Q8TPA6|MAX1_METAC Sodium/calcium exchanger MaX1 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=maX1 PE=1 SV=1 124 301 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 38 0.45

Transmembrane Domains

Domain # Start End Length
1 13 32 19
2 102 124 22
3 131 153 22
4 173 195 22
5 208 225 17
6 235 254 19
7 748 770 22
8 780 802 22
9 809 831 22
10 841 863 22
11 883 905 22
12 929 951 22
13 964 986 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|889
MQATTPRAARLPRRPFCATVVLLALLTAYSFLHQAQTARRAGRDARDAPGPSLVRRHANPVCAEIHSAPDQCDFV
RRYCKDADAGLLPYLEFYYCSPPRARPFAFVLLVAWLGLLFTTIGIAASDFFSVNLSTIASILGLSQSLAGVTFL
ALGNGSPDVFSTFAAMSSNSPSMAVGELLGAASFITGVVAGSMALVREFRVERKTYTRDICFFIVAVGFTMAFLA
DGQLRFWECWTMIAYYLLYVLTVVVWHWYAVRRKRRLRREGEARSHFYPMPGTSADDLAGEPYRDDPDDIDRGPG
HAPPSRHSTAFSDALSVSALSRLDVEGQTTTGGVHDNDDDDDDGDRERMVAAEVTRNMRVLRTGVKRHHNINPIR
PSLVGALEFRSALAQLQRESNHQLSPITGRSYSENHFDARARRGTTSVVLDVTYDEAGYEPQDGAAPRRDRALSS
GDMPISSDAIPTLAPAGRTRPRSDFLLPEAAAAGWRTPALTPPSRGSLSPTPADPFNATAGGPADRGQGLEPLPK
LQIPVPSHYGGQSEMSSPCVAFPRYTDSPLAATPSALSEHPARHDYFADLQTPAPASGPVRWWPYAMLPPPHAIL
AILFPTLQGWREKTWWDRFLSTICVPTIFLLVITLPVVDTETSDDASSVSDPVVEDLNHRAAELATPAISVIPTE
TEPTGERERLRMSPSRGNDGRPLSACKSPSSETRERQGLAAEPTDHVLVPAKAATDMAPVKEADSECQRWNRWLV
CLQLFTGPLFAVCVLWANLRDDMQQPAKELGRMVLYTVVVSLALLGTLLLTTAEHKRPRFHYLLCFMGFVISIAW
ISTVAGEVVGVLKAFGIVLGISEALLGLTIFAAGNSIGDLVADITVARLGYPVMALSACFGGPMLNILLGIGIGG
VMMMVQNAKREHAKHPEQPLRYGPYRVQVGGTLLISSITLLLILFLLLVLVPINKWILNRKIGWGVIVLWIISTV
VSVVIEMMGIWGELV*
Coding >Hirsu2|889
ATGCAGGCAACCACACCTCGGGCGGCCCGTCTGCCTCGCCGCCCCTTCTGCGCCACCGTCGTCCTGCTCGCCCTC
CTAACCGCCTATTCCTTCCTCCACCAAGCGCAGACGGCGCGCCGCGCTGGCCGCGATGCCCGCGATGCCCCCGGG
CCCTCCCTTGTCCGACGCCATGCCAACCCCGTCTGCGCCGAGATTCACTCCGCCCCGGACCAGTGCGACTTCGTC
AGGCGCTATTGCAAGGACGCCGACGCCGGCCTGCTCCCCTACCTCGAGTTCTACTACTGCAGCCCCCCCCGAGCC
CGCCCCTTCGCCTTCGTCCTCCTCGTCGCCTGGCTGGGCCTGCTCTTCACCACCATCGGCATCGCCGCCAGCGAC
TTCTTCAGCGTCAATCTCAGCACCATCGCCTCCATTCTCGGCCTGAGCCAGAGCCTGGCCGGCGTCACCTTCCTC
GCCCTCGGCAATGGCTCCCCCGACGTCTTCAGCACCTTTGCCGCCATGAGCTCCAACAGCCCCAGCATGGCCGTC
GGTGAGCTCCTCGGCGCCGCCAGCTTCATCACCGGCGTCGTCGCCGGCTCCATGGCCCTCGTCCGCGAGTTCAGG
GTCGAGCGCAAGACGTACACGCGCGACATTTGCTTCTTCATCGTCGCCGTCGGCTTCACCATGGCCTTCCTGGCC
GACGGCCAGCTCCGCTTCTGGGAGTGCTGGACCATGATCGCCTACTACCTCCTCTACGTCCTGACCGTCGTCGTC
TGGCACTGGTACGCCGTTCGCAGGAAGCGCCGGCTCCGACGCGAAGGCGAGGCTCGGAGCCACTTCTACCCCATG
CCCGGAACCTCGGCCGACGACCTGGCCGGAGAACCCTACCGTGACGACCCGGACGACATCGACCGCGGTCCGGGC
CACGCCCCACCCTCTCGCCACAGCACCGCCTTCAGCGACGCCCTTTCCGTCAGCGCCCTGTCGCGGCTCGACGTC
GAGGGGCAGACGACGACGGGCGGCGTCCACGACAACGACGACGACGACGACGACGGCGACCGAGAGCGCATGGTC
GCTGCCGAGGTCACGAGGAACATGCGCGTCCTGCGCACCGGCGTCAAACGACACCACAACATCAATCCCATCCGT
CCGAGTCTTGTCGGCGCGCTCGAGTTCCGATCGGCTTTGGCCCAGCTGCAGCGCGAGAGCAACCACCAGTTGTCG
CCCATTACCGGCCGGAGCTACTCGGAGAATCACTTCGACGCGAGGGCCCGTCGAGGAACGACAAGCGTCGTGCTC
GATGTGACGTACGACGAAGCTGGCTACGAGCCGCAAGACGGAGCTGCGCCGCGTAGGGACCGGGCGCTCTCGTCC
GGCGACATGCCAATCTCGTCGGATGCCATTCCCACCCTCGCGCCCGCGGGCCGAACCAGACCCCGCTCCGACTTC
TTGCTCCCCGAGGCGGCGGCCGCCGGCTGGAGAACGCCGGCCCTGACGCCACCGAGCAGAGGCTCGCTCTCTCCG
ACACCGGCCGACCCGTTCAATGCGACGGCCGGCGGGCCGGCGGACCGCGGCCAGGGACTGGAGCCTCTTCCGAAG
CTGCAGATACCCGTCCCGAGCCACTACGGCGGCCAAAGCGAGATGTCGTCTCCCTGCGTGGCATTTCCCCGATAC
ACGGACTCGCCGCTCGCCGCGACGCCCAGCGCGCTTTCCGAACACCCTGCGCGACACGACTATTTCGCCGACCTC
CAGACGCCGGCGCCGGCATCTGGCCCGGTGCGCTGGTGGCCGTACGCGATGCTGCCGCCGCCTCACGCCATCCTG
GCCATTCTGTTCCCTACCCTGCAAGGCTGGAGAGAGAAGACGTGGTGGGATCGCTTCCTCAGCACGATATGCGTG
CCCACCATATTCCTCTTGGTCATCACGTTGCCCGTCGTGGACACGGAGACGAGCGACGATGCGTCGTCGGTCAGC
GATCCGGTGGTCGAGGACCTGAACCACCGCGCCGCCGAACTCGCGACACCTGCCATCTCGGTGATCCCGACGGAG
ACGGAGCCTACGGGCGAGCGGGAACGGCTGCGGATGTCTCCCTCGAGGGGCAACGATGGCCGGCCGCTGTCGGCA
TGCAAGTCACCCAGCTCGGAGACGCGAGAGCGTCAGGGACTGGCGGCGGAGCCGACGGACCACGTGCTCGTCCCG
GCCAAGGCAGCAACGGACATGGCGCCGGTGAAGGAGGCCGACAGCGAGTGCCAGCGCTGGAACCGGTGGCTCGTG
TGCCTGCAGCTGTTCACCGGGCCGCTGTTCGCCGTGTGCGTGCTCTGGGCCAACCTGCGCGACGACATGCAGCAG
CCGGCCAAGGAGCTGGGGCGGATGGTGCTGTACACGGTGGTGGTGTCGCTCGCGCTGCTGGGCACGCTGCTGCTG
ACGACGGCGGAGCACAAGCGGCCCAGGTTCCACTACCTGCTCTGCTTCATGGGCTTCGTCATCAGCATCGCGTGG
ATCTCGACGGTGGCGGGCGAGGTGGTGGGGGTCCTCAAGGCGTTCGGCATCGTCCTCGGCATCTCGGAGGCGCTG
CTGGGGCTGACCATCTTCGCGGCGGGCAACAGCATCGGAGACCTGGTGGCGGACATTACTGTGGCGCGGCTGGGA
TATCCCGTCATGGCGCTGTCGGCCTGCTTCGGGGGGCCCATGCTCAACATCCTGCTGGGGATCGGCATCGGGGGC
GTCATGATGATGGTGCAGAACGCCAAGCGGGAGCACGCCAAGCATCCGGAGCAGCCGCTGCGTTACGGGCCGTAC
CGGGTGCAGGTGGGCGGAACCCTGCTGATCTCGAGCATCACGCTGCTGCTCATCCTCTTCCTGCTGCTCGTGCTG
GTGCCCATCAACAAGTGGATCCTGAACCGCAAGATAGGCTGGGGCGTCATCGTGCTGTGGATCATCAGCACGGTC
GTGAGCGTCGTCATCGAGATGATGGGCATCTGGGGCGAGCTGGTCTAG
Transcript >Hirsu2|889
ATGCAGGCAACCACACCTCGGGCGGCCCGTCTGCCTCGCCGCCCCTTCTGCGCCACCGTCGTCCTGCTCGCCCTC
CTAACCGCCTATTCCTTCCTCCACCAAGCGCAGACGGCGCGCCGCGCTGGCCGCGATGCCCGCGATGCCCCCGGG
CCCTCCCTTGTCCGACGCCATGCCAACCCCGTCTGCGCCGAGATTCACTCCGCCCCGGACCAGTGCGACTTCGTC
AGGCGCTATTGCAAGGACGCCGACGCCGGCCTGCTCCCCTACCTCGAGTTCTACTACTGCAGCCCCCCCCGAGCC
CGCCCCTTCGCCTTCGTCCTCCTCGTCGCCTGGCTGGGCCTGCTCTTCACCACCATCGGCATCGCCGCCAGCGAC
TTCTTCAGCGTCAATCTCAGCACCATCGCCTCCATTCTCGGCCTGAGCCAGAGCCTGGCCGGCGTCACCTTCCTC
GCCCTCGGCAATGGCTCCCCCGACGTCTTCAGCACCTTTGCCGCCATGAGCTCCAACAGCCCCAGCATGGCCGTC
GGTGAGCTCCTCGGCGCCGCCAGCTTCATCACCGGCGTCGTCGCCGGCTCCATGGCCCTCGTCCGCGAGTTCAGG
GTCGAGCGCAAGACGTACACGCGCGACATTTGCTTCTTCATCGTCGCCGTCGGCTTCACCATGGCCTTCCTGGCC
GACGGCCAGCTCCGCTTCTGGGAGTGCTGGACCATGATCGCCTACTACCTCCTCTACGTCCTGACCGTCGTCGTC
TGGCACTGGTACGCCGTTCGCAGGAAGCGCCGGCTCCGACGCGAAGGCGAGGCTCGGAGCCACTTCTACCCCATG
CCCGGAACCTCGGCCGACGACCTGGCCGGAGAACCCTACCGTGACGACCCGGACGACATCGACCGCGGTCCGGGC
CACGCCCCACCCTCTCGCCACAGCACCGCCTTCAGCGACGCCCTTTCCGTCAGCGCCCTGTCGCGGCTCGACGTC
GAGGGGCAGACGACGACGGGCGGCGTCCACGACAACGACGACGACGACGACGACGGCGACCGAGAGCGCATGGTC
GCTGCCGAGGTCACGAGGAACATGCGCGTCCTGCGCACCGGCGTCAAACGACACCACAACATCAATCCCATCCGT
CCGAGTCTTGTCGGCGCGCTCGAGTTCCGATCGGCTTTGGCCCAGCTGCAGCGCGAGAGCAACCACCAGTTGTCG
CCCATTACCGGCCGGAGCTACTCGGAGAATCACTTCGACGCGAGGGCCCGTCGAGGAACGACAAGCGTCGTGCTC
GATGTGACGTACGACGAAGCTGGCTACGAGCCGCAAGACGGAGCTGCGCCGCGTAGGGACCGGGCGCTCTCGTCC
GGCGACATGCCAATCTCGTCGGATGCCATTCCCACCCTCGCGCCCGCGGGCCGAACCAGACCCCGCTCCGACTTC
TTGCTCCCCGAGGCGGCGGCCGCCGGCTGGAGAACGCCGGCCCTGACGCCACCGAGCAGAGGCTCGCTCTCTCCG
ACACCGGCCGACCCGTTCAATGCGACGGCCGGCGGGCCGGCGGACCGCGGCCAGGGACTGGAGCCTCTTCCGAAG
CTGCAGATACCCGTCCCGAGCCACTACGGCGGCCAAAGCGAGATGTCGTCTCCCTGCGTGGCATTTCCCCGATAC
ACGGACTCGCCGCTCGCCGCGACGCCCAGCGCGCTTTCCGAACACCCTGCGCGACACGACTATTTCGCCGACCTC
CAGACGCCGGCGCCGGCATCTGGCCCGGTGCGCTGGTGGCCGTACGCGATGCTGCCGCCGCCTCACGCCATCCTG
GCCATTCTGTTCCCTACCCTGCAAGGCTGGAGAGAGAAGACGTGGTGGGATCGCTTCCTCAGCACGATATGCGTG
CCCACCATATTCCTCTTGGTCATCACGTTGCCCGTCGTGGACACGGAGACGAGCGACGATGCGTCGTCGGTCAGC
GATCCGGTGGTCGAGGACCTGAACCACCGCGCCGCCGAACTCGCGACACCTGCCATCTCGGTGATCCCGACGGAG
ACGGAGCCTACGGGCGAGCGGGAACGGCTGCGGATGTCTCCCTCGAGGGGCAACGATGGCCGGCCGCTGTCGGCA
TGCAAGTCACCCAGCTCGGAGACGCGAGAGCGTCAGGGACTGGCGGCGGAGCCGACGGACCACGTGCTCGTCCCG
GCCAAGGCAGCAACGGACATGGCGCCGGTGAAGGAGGCCGACAGCGAGTGCCAGCGCTGGAACCGGTGGCTCGTG
TGCCTGCAGCTGTTCACCGGGCCGCTGTTCGCCGTGTGCGTGCTCTGGGCCAACCTGCGCGACGACATGCAGCAG
CCGGCCAAGGAGCTGGGGCGGATGGTGCTGTACACGGTGGTGGTGTCGCTCGCGCTGCTGGGCACGCTGCTGCTG
ACGACGGCGGAGCACAAGCGGCCCAGGTTCCACTACCTGCTCTGCTTCATGGGCTTCGTCATCAGCATCGCGTGG
ATCTCGACGGTGGCGGGCGAGGTGGTGGGGGTCCTCAAGGCGTTCGGCATCGTCCTCGGCATCTCGGAGGCGCTG
CTGGGGCTGACCATCTTCGCGGCGGGCAACAGCATCGGAGACCTGGTGGCGGACATTACTGTGGCGCGGCTGGGA
TATCCCGTCATGGCGCTGTCGGCCTGCTTCGGGGGGCCCATGCTCAACATCCTGCTGGGGATCGGCATCGGGGGC
GTCATGATGATGGTGCAGAACGCCAAGCGGGAGCACGCCAAGCATCCGGAGCAGCCGCTGCGTTACGGGCCGTAC
CGGGTGCAGGTGGGCGGAACCCTGCTGATCTCGAGCATCACGCTGCTGCTCATCCTCTTCCTGCTGCTCGTGCTG
GTGCCCATCAACAAGTGGATCCTGAACCGCAAGATAGGCTGGGGCGTCATCGTGCTGTGGATCATCAGCACGGTC
GTGAGCGTCGTCATCGAGATGATGGGCATCTGGGGCGAGCTGGTCTAG
Gene >Hirsu2|889
ATGCAGGCAACCACACCTCGGGCGGCCCGTCTGCCTCGCCGCCCCTTCTGCGCCACCGTCGTCCTGCTCGCCCTC
CTAACCGCCTATTCCTTCCTCCACCAAGCGCAGACGGCGCGCCGCGCTGGCCGCGATGCCCGCGATGCCCCCGGG
CCCTCCCTTGTCCGACGCCATGCCAACCCCGTCTGCGCCGAGATTCACTCCGCCCCGGACCAGTGCGACTTCGTC
AGGCGCTATTGCAAGGACGCCGACGCCGGCCTGCTCCCCTACCTCGAGTTCTACTACTGCAGCCCCCCCCGAGCC
CGCCCCTTCGCCTTCGTCCTCCTCGTCGCCTGGCTGGGCCTGCTCTTCACCACCATCGGCATCGCCGCCAGCGAC
TTCTTCAGCGTCAATCTCAGCACCATCGCCTCCATTCTCGGCCTGAGCCAGAGCCTGGCCGGCGTCACCTTCCTC
GCCCTCGGCAATGGCTCCCCCGACGTCTTCAGCACCTTTGCCGCCATGAGCTCCAACAGCCCCAGCATGGCCGTC
GGTGAGCTCCTCGGCGCCGCCAGCTTCATCACCGGCGTCGTCGCCGGCTCCATGGCCCTCGTCCGCGAGTTCAGG
GTCGAGCGCAAGACGTACACGCGCGACATTTGCTTCTTCATCGTCGCCGTCGGCTTCACCATGGCCTTCCTGGCC
GACGGCCAGCTCCGCTTCTGGGAGTGCTGGACCATGATCGCCTACTACCTCCTCTACGTCCTGACCGTCGTCGTC
TGGCACTGGTACGCCGTTCGCAGGAAGCGCCGGCTCCGACGCGAAGGCGAGGCTCGGAGCCACTTCTACCCCATG
CCCGGAACCTCGGCCGACGACCTGGCCGGAGAACCCTACCGTGACGACCCGGACGACATCGACCGCGGTCCGGGC
CACGCCCCACCCTCTCGCCACAGCACCGCCTTCAGCGACGCCCTTTCCGTCAGCGCCCTGTCGCGGCTCGACGTC
GAGGGGCAGACGACGACGGGCGGCGTCCACGACAACGACGACGACGACGACGACGGCGACCGAGAGCGCATGGTC
GCTGCCGAGGTCACGAGGAACATGCGCGTCCTGCGCACCGGCGTCAAACGACACCACAACATCAATCCCATCCGT
CCGAGTCTTGTCGGCGCGCTCGAGTTCCGATCGGCTTTGGCCCAGCTGCAGCGCGAGAGCAACCACCAGTTGTCG
CCCATTACCGGCCGGAGCTACTCGGAGAATCACTTCGACGCGAGGGCCCGTCGAGGAACGACAAGCGTCGTGCTC
GATGTGACGTACGACGAAGCTGGCTACGAGCCGCAAGACGGAGCTGCGCCGCGTAGGGACCGGGCGCTCTCGTCC
GGCGACATGCCAATCTCGTCGGATGCCATTCCCACCCTCGCGCCCGCGGGCCGAACCAGACCCCGCTCCGACTTC
TTGCTCCCCGAGGCGGCGGCCGCCGGCTGGAGAACGCCGGCCCTGACGCCACCGAGCAGAGGCTCGCTCTCTCCG
ACACCGGCCGACCCGTTCAATGCGACGGCCGGCGGGCCGGCGGACCGCGGCCAGGGACTGGAGCCTCTTCCGAAG
CTGCAGATACCCGTCCCGAGCCACTACGGCGGCCAAAGCGAGATGTCGTCTCCCTGCGTGGCATTTCCCCGATAC
ACGGACTCGCCGCTCGCCGCGACGCCCAGCGCGCTTTCCGAACACCCTGCGCGACACGACTATTTCGCCGACCTC
CAGACGCCGGCGCCGGCATCTGGCCCGGTGCGCTGGTGGCCGTACGCGATGCTGCCGCCGCCTCACGCCATCCTG
GCCATTCTGTTCCCTACCCTGCAAGGCTGGAGAGAGAAGACGTGGTGGGATCGCTTCCTCAGCACGATATGCGTG
CCCACCATATTCCTCTTGGTCATCACGTTGCCCGTCGTGGACACGGAGACGAGCGACGATGCGTCGTCGGTCAGC
GATCCGGTGGTCGAGGACCTGAACCACCGCGCCGCCGAACTCGCGACACCTGCCATCTCGGTGATCCCGACGGAG
ACGGAGCCTACGGGCGAGCGGGAACGGCTGCGGATGTCTCCCTCGAGGGGCAACGATGGCCGGCCGCTGTCGGCA
TGCAAGTCACCCAGCTCGGAGACGCGAGAGCGTCAGGGACTGGCGGCGGAGCCGACGGACCACGTGCTCGTCCCG
GCCAAGGCAGCAACGGACATGGCGCCGGTGAAGGAGGCCGACAGCGAGTGCCAGCGCTGGAACCGGTGGCTCGTG
TGCCTGCAGCTGTTCACCGGGCCGCTGTTCGCCGTGTGCGTGCTCTGGGCCAACCTGCGCGACGACATGCAGCAG
CCGGCCAAGGAGCTGGGGCGGATGGTGCTGTACACGGTGGTGGTGTCGCTCGCGCTGCTGGGCACGCTGCTGCTG
ACGACGGCGGAGCACAAGCGGCCCAGGTTCCACTACCTGCTCTGCTTCATGGGCTTCGTCATCAGCATCGCGTGG
ATCTCGACGGTGGCGGGCGAGGTGGTGGGGGTCCTCAAGGCGTTCGGCATCGTCCTCGGCATCTCGGAGGCGCTG
CTGGGGCTGACCATCTTCGCGGCGGGCAACAGCATCGGAGACCTGGTGGCGGACATTACTGTGGCGCGGCTGGGA
TATCCCGTCATGGCGCTGTAAGTCGGCTCGGCGCGACGAGAGCGAGAGAGGAGAGAGAGAATGCTAACGTGTCGG
TGGCGCAGGTCGGCCTGCTTCGGGGGGCCCATGCTCAACATCCTGCTGGGGATCGGCATCGGGGGCGTCATGATG
ATGGTGCAGAACGCCAAGCGGGAGCACGCCAAGCATCCGGAGCAGCCGCTGCGTTACGGGCCGTACCGGGTGCAG
GTGGGCGGAACCCTGCTGATCTCGAGCATCACGCTGCTGCTCATCCTCTTCCTGCTGCTCGTGCTGGTGCCCATC
AACAAGTGGATCCTGAACCGCAAGATAGGCTGGGGCGTCATCGTGCTGTGGATCATCAGCACGGTCGTGAGCGTC
GTCATCGAGATGATGGGCATCTGGGGCGAGCTGGTCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail