Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8889
Gene name
LocationContig_609:14834..15489
Strand+
Gene length (bp)655
Transcript length (bp)540
Coding sequence length (bp)540
Protein length (aa) 180

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 2.6E-05 101 173

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P98187|CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 40 176 9.0E-08

GO

GO Term Description Terminal node
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0020037 heme binding Yes
GO:0005506 iron ion binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0046872 metal ion binding No
GO:0016491 oxidoreductase activity No
GO:0046906 tetrapyrrole binding No
GO:0043169 cation binding No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 36 58 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8889
MGLPWRQMAAAALAGSALTAMATDRLRSRKHVAQSFALLWLVQVVVWAVWSTFVYPHLLSPLRHLPTPAGAHWLL
GHSRKLVGESPGAPLREWITGMEHDGLIRYLFAFNRERLLVSSPKALAEVLVSKNYMFEKPIAVRNALGRVLGNG
ILLAEGDEHKVQRRNLLPAFHYRHIKDLP*
Coding >Hirsu2|8889
ATGGGACTGCCGTGGCGGCAGATGGCGGCGGCGGCGCTCGCGGGCAGCGCGCTCACGGCCATGGCGACGGACCGG
CTGCGCTCGCGCAAGCACGTCGCCCAGTCCTTCGCCCTGCTGTGGCTGGTCCAGGTGGTCGTCTGGGCCGTCTGG
TCGACCTTTGTCTATCCGCACCTGCTGTCGCCGCTCCGTCACCTGCCGACGCCGGCCGGCGCCCACTGGCTGCTG
GGCCACAGCCGCAAGCTCGTGGGCGAGTCGCCGGGCGCCCCCCTGAGGGAATGGATCACGGGCATGGAGCACGAC
GGCCTCATCCGCTACCTCTTCGCCTTCAACCGCGAGCGACTCCTCGTCAGCTCGCCCAAGGCGCTGGCCGAGGTG
CTCGTGTCCAAGAACTACATGTTCGAGAAGCCGATCGCGGTGCGCAACGCGCTCGGGCGCGTCCTCGGCAACGGC
ATCCTGCTGGCCGAGGGCGACGAGCACAAGGTGCAGCGGCGCAACCTGCTGCCGGCCTTCCACTACCGCCACATC
AAGGACCTGCCATGA
Transcript >Hirsu2|8889
ATGGGACTGCCGTGGCGGCAGATGGCGGCGGCGGCGCTCGCGGGCAGCGCGCTCACGGCCATGGCGACGGACCGG
CTGCGCTCGCGCAAGCACGTCGCCCAGTCCTTCGCCCTGCTGTGGCTGGTCCAGGTGGTCGTCTGGGCCGTCTGG
TCGACCTTTGTCTATCCGCACCTGCTGTCGCCGCTCCGTCACCTGCCGACGCCGGCCGGCGCCCACTGGCTGCTG
GGCCACAGCCGCAAGCTCGTGGGCGAGTCGCCGGGCGCCCCCCTGAGGGAATGGATCACGGGCATGGAGCACGAC
GGCCTCATCCGCTACCTCTTCGCCTTCAACCGCGAGCGACTCCTCGTCAGCTCGCCCAAGGCGCTGGCCGAGGTG
CTCGTGTCCAAGAACTACATGTTCGAGAAGCCGATCGCGGTGCGCAACGCGCTCGGGCGCGTCCTCGGCAACGGC
ATCCTGCTGGCCGAGGGCGACGAGCACAAGGTGCAGCGGCGCAACCTGCTGCCGGCCTTCCACTACCGCCACATC
AAGGACCTGCCATGA
Gene >Hirsu2|8889
ATGGGACTGCCGTGGCGGCAGATGGCGGCGGCGGCGCTCGCGGGCAGCGCGCTCACGGCCATGGCGACGGACCGG
CTGCGCTCGCGCAAGCACGTCGCCCAGTCCTTCGCCCTGCTGTGGCTGGTCCAGGTGGTCGTCTGGGCCGTCTGG
TCGACCTTTGTCTATCCGCACCTGCTGTCGCCGCTCCGTCACCTGCCGACGCCGGCCGGCGCCCACTGGCTGCTG
GGCCACAGCCGCAAGCTCGTGGGCGAGTCGCCGGGCGCCCCCCTGAGGGAATGGTCAGTTCGCGGTGTTTGATGC
GGATGGCGGGCGGACGCGCTGAACTTCCCCCCCCCCTCCCCCCAAACAAATAGGATCACGGGCATGGAGCACGAC
GGCCTCATCCGCTACCTCTTCGCCTTCAACCGCGAGCGACTCCTCGTCAGCTCGCCCAAGGCGCTGGCCGAGGTG
CTCGTGTCCAAGAACTACATGTTCGAGAAGCCGATCGCGGTGCGCAACGCGCTCGGGCGCGTCCTCGGCAACGGC
ATCCTGCTGGCCGAGGGCGACGAGCACAAGGTGCAGCGGCGCAACCTGCTGCCGGCCTTCCACTACCGCCACATC
AAGGACCTGTACCCTACTTTCTGGGTCAAGGCGCGCGAGGTGGTCGAGGCCATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail