Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8885
Gene name
LocationContig_608:13555..14671
Strand+
Gene length (bp)1116
Transcript length (bp)621
Coding sequence length (bp)621
Protein length (aa) 207

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC) 6.4E-40 40 175

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96VL0|SODC_CLAP2 Superoxide dismutase [Cu-Zn] OS=Claviceps purpurea (strain 20.1) GN=SOD1 PE=3 SV=3 27 174 7.0E-75
sp|Q8J0N3|SODC_ISATE Superoxide dismutase [Cu-Zn] OS=Isaria tenuipes GN=SOD1 PE=3 SV=3 27 174 2.0E-74
sp|O94178|SODC_COLGL Superoxide dismutase [Cu-Zn] OS=Colletotrichum gloeosporioides GN=SOD1 PE=3 SV=3 27 174 2.0E-74
sp|Q8J0N2|SODC_CORMI Superoxide dismutase [Cu-Zn] OS=Cordyceps militaris GN=SOD1 PE=2 SV=3 27 174 9.0E-74
sp|Q711T9|SODC_PODAS Superoxide dismutase [Cu-Zn] OS=Podospora anserina GN=SOD1 PE=3 SV=3 27 174 4.0E-72
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96VL0|SODC_CLAP2 Superoxide dismutase [Cu-Zn] OS=Claviceps purpurea (strain 20.1) GN=SOD1 PE=3 SV=3 27 174 7.0E-75
sp|Q8J0N3|SODC_ISATE Superoxide dismutase [Cu-Zn] OS=Isaria tenuipes GN=SOD1 PE=3 SV=3 27 174 2.0E-74
sp|O94178|SODC_COLGL Superoxide dismutase [Cu-Zn] OS=Colletotrichum gloeosporioides GN=SOD1 PE=3 SV=3 27 174 2.0E-74
sp|Q8J0N2|SODC_CORMI Superoxide dismutase [Cu-Zn] OS=Cordyceps militaris GN=SOD1 PE=2 SV=3 27 174 9.0E-74
sp|Q711T9|SODC_PODAS Superoxide dismutase [Cu-Zn] OS=Podospora anserina GN=SOD1 PE=3 SV=3 27 174 4.0E-72
sp|Q6FWL5|SODC_CANGA Superoxide dismutase [Cu-Zn] OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SOD1 PE=3 SV=3 27 174 4.0E-72
sp|P07509|SODC_NEUCR Superoxide dismutase [Cu-Zn] OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sod-1 PE=1 SV=3 27 174 1.0E-71
sp|O59924|SODC_CANAX Superoxide dismutase [Cu-Zn] OS=Candida albicans GN=SOD1 PE=3 SV=3 27 174 2.0E-71
sp|Q9HEY7|SODC_EMENI Superoxide dismutase [Cu-Zn] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sodA PE=1 SV=3 27 174 4.0E-71
sp|P00445|SODC_YEAST Superoxide dismutase [Cu-Zn] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOD1 PE=1 SV=2 27 174 1.0E-70
sp|Q6C662|SODC_YARLI Superoxide dismutase [Cu-Zn] OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SOD1 PE=3 SV=3 27 174 2.0E-70
sp|Q6CPE2|SODC_KLULA Superoxide dismutase [Cu-Zn] OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SOD1 PE=3 SV=1 27 174 3.0E-70
sp|Q9Y8D9|SODC_ASPFU Superoxide dismutase [Cu-Zn] OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sodC PE=2 SV=3 27 174 3.0E-70
sp|P83684|SODC_HUMLT Superoxide dismutase [Cu-Zn] OS=Humicola lutea PE=1 SV=2 27 174 3.0E-70
sp|Q70Q35|SODC_BOTFU Superoxide dismutase [Cu-Zn] OS=Botryotinia fuckeliana GN=sod1 PE=3 SV=3 27 174 3.0E-70
sp|A2QMY6|SODC_ASPNC Superoxide dismutase [Cu-Zn] OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sodC PE=3 SV=1 27 174 1.0E-68
sp|O42724|SODC1_DEBHA Superoxide dismutase [Cu-Zn] 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SOD1 PE=1 SV=4 27 174 2.0E-68
sp|P85978|SODC_ASPNG Superoxide dismutase [Cu-Zn] OS=Aspergillus niger GN=sodC PE=1 SV=2 27 174 4.0E-68
sp|Q877B5|SODC_ASPOR Superoxide dismutase [Cu-Zn] OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sodC PE=3 SV=3 27 174 3.0E-67
sp|Q8X1S6|SODC_ASPFL Superoxide dismutase [Cu-Zn] OS=Aspergillus flavus GN=sodC PE=3 SV=3 27 174 1.0E-64
sp|Q6T3B0|SODC_POLSN Superoxide dismutase [Cu-Zn] OS=Polycephalomyces sinensis GN=SOD1 PE=3 SV=3 27 174 9.0E-64
sp|Q751L8|SODC_ASHGO Superoxide dismutase [Cu-Zn] OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SOD1 PE=3 SV=4 27 174 3.0E-61
sp|Q9C0N4|SODC_CRYGA Superoxide dismutase [Cu-Zn] OS=Cryptococcus gattii GN=SOD1 PE=2 SV=3 27 174 6.0E-59
sp|P28758|SODC_SCHPO Superoxide dismutase [Cu-Zn] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sod1 PE=2 SV=1 27 174 2.0E-57
sp|O04996|SODC_SOLCS Superoxide dismutase [Cu-Zn] OS=Solidago canadensis var. scabra GN=SODCC PE=2 SV=3 27 174 6.0E-53
sp|P27082|SODC_NICPL Superoxide dismutase [Cu-Zn] OS=Nicotiana plumbaginifolia GN=SODCC PE=2 SV=2 27 174 1.0E-52
sp|Q43779|SODC2_SOLLC Superoxide dismutase [Cu-Zn] 2 OS=Solanum lycopersicum GN=SODCC.5 PE=3 SV=3 27 174 7.0E-52
sp|O22373|SODC_CAPAN Superoxide dismutase [Cu-Zn] OS=Capsicum annuum GN=SODCC PE=2 SV=1 27 174 7.0E-52
sp|P11428|SODC2_MAIZE Superoxide dismutase [Cu-Zn] 2 OS=Zea mays GN=SODCC.1 PE=2 SV=2 27 174 2.0E-51
sp|Q95086|SODC_DROPS Superoxide dismutase [Cu-Zn] OS=Drosophila pseudoobscura pseudoobscura GN=Sod PE=3 SV=3 27 174 3.0E-51
sp|P93258|SODC1_MESCR Superoxide dismutase [Cu-Zn] 1 OS=Mesembryanthemum crystallinum GN=SODCC.1 PE=2 SV=1 27 174 3.0E-51
sp|O65174|SODC_ZANAE Superoxide dismutase [Cu-Zn] OS=Zantedeschia aethiopica GN=SODCC PE=2 SV=1 27 174 3.0E-51
sp|Q07796|SODC_IPOBA Superoxide dismutase [Cu-Zn] OS=Ipomoea batatas GN=SODCC PE=2 SV=2 27 174 8.0E-51
sp|O73872|SODC_DANRE Superoxide dismutase [Cu-Zn] OS=Danio rerio GN=sod1 PE=2 SV=1 29 174 8.0E-51
sp|P41973|SODC_DROWI Superoxide dismutase [Cu-Zn] OS=Drosophila willistoni GN=Sod PE=3 SV=2 27 174 1.0E-50
sp|O22668|SODC_PANGI Superoxide dismutase [Cu-Zn] OS=Panax ginseng GN=SODCC PE=2 SV=1 27 174 2.0E-50
sp|Q8HXQ3|SODC_HYLLA Superoxide dismutase [Cu-Zn] OS=Hylobates lar GN=SOD1 PE=2 SV=3 28 174 2.0E-50
sp|P14830|SODC1_SOLLC Superoxide dismutase [Cu-Zn] 1 OS=Solanum lycopersicum GN=SODCC.1 PE=2 SV=2 27 174 2.0E-50
sp|Q07182|SODC_CHYAM Superoxide dismutase [Cu-Zn] OS=Chymomyza amoena GN=Sod PE=3 SV=2 29 174 3.0E-50
sp|P23346|SODC5_MAIZE Superoxide dismutase [Cu-Zn] 4AP OS=Zea mays GN=SODCC.2 PE=2 SV=2 27 174 4.0E-50
sp|P23345|SODC4_MAIZE Superoxide dismutase [Cu-Zn] 4A OS=Zea mays GN=SODCC.3 PE=2 SV=2 27 174 4.0E-50
sp|Q8HXP8|SODC_CALJA Superoxide dismutase [Cu-Zn] OS=Callithrix jacchus GN=SOD1 PE=2 SV=3 28 174 5.0E-50
sp|P10791|SODC_DROVI Superoxide dismutase [Cu-Zn] OS=Drosophila virilis GN=Sod PE=3 SV=2 27 174 7.0E-50
sp|Q8L5E0|ALL5B_OLEEU Superoxide dismutase [Cu-Zn] 2 OS=Olea europaea GN=OLE5 PE=1 SV=2 27 174 7.0E-50
sp|Q8HXQ0|SODC_MACMU Superoxide dismutase [Cu-Zn] OS=Macaca mulatta GN=SOD1 PE=2 SV=3 28 174 7.0E-50
sp|Q8HXQ2|SODC_MACFU Superoxide dismutase [Cu-Zn] OS=Macaca fuscata fuscata GN=SOD1 PE=2 SV=3 28 174 7.0E-50
sp|Q8HXQ1|SODC_MACFA Superoxide dismutase [Cu-Zn] OS=Macaca fascicularis GN=SOD1 PE=2 SV=3 28 174 7.0E-50
sp|O49073|SODC_PAUKA Superoxide dismutase [Cu-Zn] OS=Paulownia kawakamii GN=SODCC PE=2 SV=1 27 174 9.0E-50
sp|P11418|SODC_PRIGL Superoxide dismutase [Cu-Zn] OS=Prionace glauca GN=sod1 PE=1 SV=1 28 174 1.0E-49
sp|P08228|SODC_MOUSE Superoxide dismutase [Cu-Zn] OS=Mus musculus GN=Sod1 PE=1 SV=2 28 174 1.0E-49
sp|Q9U4X3|SODC_DROYA Superoxide dismutase [Cu-Zn] OS=Drosophila yakuba GN=Sod PE=3 SV=3 27 174 2.0E-49
sp|P24706|SODC_ONCVO Superoxide dismutase [Cu-Zn] OS=Onchocerca volvulus GN=sod-1 PE=3 SV=1 30 174 2.0E-49
sp|Q9U4X5|SODC_DROOR Superoxide dismutase [Cu-Zn] OS=Drosophila orena GN=Sod PE=3 SV=3 27 174 2.0E-49
sp|Q7M1R5|SODC_SOYBN Superoxide dismutase [Cu-Zn] OS=Glycine max GN=SOD1 PE=3 SV=1 27 174 2.0E-49
sp|P28757|SODC2_ORYSJ Superoxide dismutase [Cu-Zn] 2 OS=Oryza sativa subsp. japonica GN=SODCC2 PE=1 SV=2 27 174 3.0E-49
sp|P07505|SODCP_SPIOL Superoxide dismutase [Cu-Zn], chloroplastic OS=Spinacia oleracea GN=SODCP PE=1 SV=2 29 174 3.0E-49
sp|Q27666|SODC_HAECO Superoxide dismutase [Cu-Zn] OS=Haemonchus contortus GN=SOD PE=2 SV=1 29 181 4.0E-49
sp|Q8HXP9|SODC_SAPAP Superoxide dismutase [Cu-Zn] OS=Sapajus apella GN=SOD1 PE=2 SV=3 28 174 4.0E-49
sp|Q0DRV6|SODC1_ORYSJ Superoxide dismutase [Cu-Zn] 1 OS=Oryza sativa subsp. japonica GN=SODCC1 PE=1 SV=1 27 174 5.0E-49
sp|A2XGP6|SODC1_ORYSI Superoxide dismutase [Cu-Zn] 1 OS=Oryza sativa subsp. indica GN=SODCC1 PE=2 SV=2 27 174 5.0E-49
sp|Q9U4X2|SODC_DROTE Superoxide dismutase [Cu-Zn] OS=Drosophila teissieri GN=Sod PE=3 SV=3 27 174 5.0E-49
sp|A8XCP3|SODC_CAEBR Superoxide dismutase [Cu-Zn] OS=Caenorhabditis briggsae GN=sod-1 PE=3 SV=1 29 182 6.0E-49
sp|Q02610|SODC_PEA Superoxide dismutase [Cu-Zn] OS=Pisum sativum GN=SODCC PE=2 SV=2 27 174 7.0E-49
sp|P24669|SODC_PINSY Superoxide dismutase [Cu-Zn] OS=Pinus sylvestris GN=SODCC PE=2 SV=1 27 174 9.0E-49
sp|P11964|SODCP_PEA Superoxide dismutase [Cu-Zn], chloroplastic OS=Pisum sativum GN=SODCP PE=2 SV=1 29 174 9.0E-49
sp|Q9U4X4|SODC_DROER Superoxide dismutase [Cu-Zn] OS=Drosophila erecta GN=Sod PE=3 SV=3 27 174 1.0E-48
sp|P61852|SODC_DROSI Superoxide dismutase [Cu-Zn] OS=Drosophila simulans GN=Sod PE=3 SV=2 27 174 1.0E-48
sp|P61854|SODC_DROSE Superoxide dismutase [Cu-Zn] OS=Drosophila sechellia GN=Sod PE=3 SV=2 27 174 1.0E-48
sp|P61851|SODC_DROME Superoxide dismutase [Cu-Zn] OS=Drosophila melanogaster GN=Sod PE=1 SV=2 27 174 1.0E-48
sp|P61853|SODC_DROMA Superoxide dismutase [Cu-Zn] OS=Drosophila mauritiana GN=Sod PE=3 SV=2 27 174 1.0E-48
sp|P41962|SODC_BRUPA Superoxide dismutase [Cu-Zn] OS=Brugia pahangi GN=SODC PE=2 SV=1 31 174 2.0E-48
sp|P22233|SODC_SPIOL Superoxide dismutase [Cu-Zn] OS=Spinacia oleracea GN=SODCC PE=2 SV=1 27 174 2.0E-48
sp|O65768|SODC_CARPA Superoxide dismutase [Cu-Zn] OS=Carica papaya GN=SODCC PE=2 SV=1 27 174 2.0E-48
sp|P34697|SODC_CAEEL Superoxide dismutase [Cu-Zn] OS=Caenorhabditis elegans GN=sod-1 PE=1 SV=2 29 182 5.0E-48
sp|P07632|SODC_RAT Superoxide dismutase [Cu-Zn] OS=Rattus norvegicus GN=Sod1 PE=1 SV=2 28 174 5.0E-48
sp|O65198|SODCP_MEDSA Superoxide dismutase [Cu-Zn], chloroplastic OS=Medicago sativa GN=SODCP PE=2 SV=1 34 174 5.0E-48
sp|O78310|SODC2_ARATH Superoxide dismutase [Cu-Zn] 2, chloroplastic OS=Arabidopsis thaliana GN=CSD2 PE=1 SV=2 29 174 8.0E-48
sp|P10792|SODCP_PETHY Superoxide dismutase [Cu-Zn], chloroplastic OS=Petunia hybrida GN=SODCP PE=2 SV=1 29 174 9.0E-48
sp|Q9SQL5|SODC_ANACO Superoxide dismutase [Cu-Zn] OS=Ananas comosus GN=SOD1 PE=2 SV=1 27 174 1.0E-47
sp|O04997|SODCP_SOLCS Superoxide dismutase [Cu-Zn], chloroplastic OS=Solidago canadensis var. scabra GN=SODCP PE=2 SV=1 29 174 2.0E-47
sp|Q55GQ5|SODC1_DICDI Superoxide dismutase [Cu-Zn] 1 OS=Dictyostelium discoideum GN=sodA PE=2 SV=1 30 174 4.0E-47
sp|P60052|SODC_PANTR Superoxide dismutase [Cu-Zn] OS=Pan troglodytes GN=SOD1 PE=2 SV=2 29 174 4.0E-47
sp|P00441|SODC_HUMAN Superoxide dismutase [Cu-Zn] OS=Homo sapiens GN=SOD1 PE=1 SV=2 29 174 4.0E-47
sp|P00443|SODC_HORSE Superoxide dismutase [Cu-Zn] OS=Equus caballus GN=SOD1 PE=1 SV=2 28 174 7.0E-47
sp|P93407|SODCP_ORYSJ Superoxide dismutase [Cu-Zn], chloroplastic OS=Oryza sativa subsp. japonica GN=SODCP PE=1 SV=1 29 174 7.0E-47
sp|P82205|SODC_BOMMO Superoxide dismutase [Cu-Zn] OS=Bombyx mori PE=1 SV=3 29 174 1.0E-46
sp|P14831|SODCP_SOLLC Superoxide dismutase [Cu-Zn], chloroplastic OS=Solanum lycopersicum GN=SODCP.2 PE=1 SV=1 29 174 2.0E-46
sp|P24704|SODC1_ARATH Superoxide dismutase [Cu-Zn] 1 OS=Arabidopsis thaliana GN=CSD1 PE=1 SV=2 27 174 2.0E-46
sp|P33431|SODC_CAVPO Superoxide dismutase [Cu-Zn] OS=Cavia porcellus GN=SOD1 PE=1 SV=3 29 174 2.0E-46
sp|O65199|SODCP_VITVI Superoxide dismutase [Cu-Zn], chloroplastic OS=Vitis vinifera GN=SODCP PE=2 SV=1 29 174 3.0E-46
sp|P09678|SODC_BRAOC Superoxide dismutase [Cu-Zn] OS=Brassica oleracea var. capitata GN=SODCC PE=1 SV=2 27 174 3.0E-46
sp|P15107|SOD1B_XENLA Superoxide dismutase [Cu-Zn] B OS=Xenopus laevis GN=sod1-b PE=1 SV=3 27 174 5.0E-46
sp|P03946|SODC_XIPGL Superoxide dismutase [Cu-Zn] OS=Xiphias gladius GN=sod1 PE=1 SV=2 27 174 6.0E-46
sp|P09670|SODC_SHEEP Superoxide dismutase [Cu-Zn] OS=Ovis aries GN=SOD1 PE=1 SV=2 29 174 6.0E-46
sp|Q52RN5|SODC_BOSMU Superoxide dismutase [Cu-Zn] OS=Bos mutus grunniens GN=SOD1 PE=2 SV=3 29 174 7.0E-46
sp|Q07449|SODE_ONCVO Extracellular superoxide dismutase [Cu-Zn] OS=Onchocerca volvulus GN=sod-4 PE=1 SV=1 29 174 9.0E-46
sp|Q8HXQ4|SODC_PONPY Superoxide dismutase [Cu-Zn] OS=Pongo pygmaeus GN=SOD1 PE=2 SV=3 29 174 1.0E-45
sp|P28755|SODC_CERCA Superoxide dismutase [Cu-Zn] OS=Ceratitis capitata GN=Sod PE=3 SV=2 27 174 2.0E-45
sp|P81926|SODC_HALRO Superoxide dismutase [Cu-Zn] OS=Halocynthia roretzi PE=1 SV=2 28 174 2.0E-45
sp|P54407|SODC_DROBS Superoxide dismutase [Cu-Zn] (Fragment) OS=Drosophila busckii GN=Sod PE=3 SV=1 34 174 5.0E-45
sp|O46412|SODC_CEREL Superoxide dismutase [Cu-Zn] OS=Cervus elaphus GN=SOD1 PE=2 SV=3 29 174 5.0E-45
sp|P00442|SODC_BOVIN Superoxide dismutase [Cu-Zn] OS=Bos taurus GN=SOD1 PE=1 SV=2 29 174 7.0E-45
sp|P13926|SOD1A_XENLA Superoxide dismutase [Cu-Zn] A OS=Xenopus laevis GN=sod1-a PE=1 SV=2 27 177 1.0E-44
sp|P41963|SODE_BRUPA Extracellular superoxide dismutase [Cu-Zn] OS=Brugia pahangi PE=2 SV=1 30 174 4.0E-44
sp|P80566|SODC_CHICK Superoxide dismutase [Cu-Zn] OS=Gallus gallus GN=SOD1 PE=1 SV=3 28 174 5.0E-44
sp|Q8WNN6|SODC_CANLF Superoxide dismutase [Cu-Zn] OS=Canis lupus familiaris GN=SOD1 PE=2 SV=1 28 174 6.0E-44
sp|Q42612|SODC2_BRAJU Superoxide dismutase [Cu-Zn] 2 OS=Brassica juncea GN=SODCC2 PE=2 SV=3 27 174 1.0E-43
sp|Q0IIW3|SODC_XENTR Superoxide dismutase [Cu-Zn] OS=Xenopus tropicalis GN=sod1 PE=2 SV=1 27 174 1.0E-43
sp|Q5FB29|SODC_CAPHI Superoxide dismutase [Cu-Zn] OS=Capra hircus GN=SOD1 PE=2 SV=3 29 174 2.0E-43
sp|P04178|SODC_PIG Superoxide dismutase [Cu-Zn] OS=Sus scrofa GN=SOD1 PE=1 SV=2 29 174 2.0E-43
sp|P09212|SODC_RABIT Superoxide dismutase [Cu-Zn] OS=Oryctolagus cuniculus GN=SOD1 PE=1 SV=3 29 174 4.0E-43
sp|O65175|SODCP_ZANAE Superoxide dismutase [Cu-Zn], chloroplastic OS=Zantedeschia aethiopica GN=SODCP PE=2 SV=1 29 174 7.0E-43
sp|Q42611|SODC1_BRAJU Superoxide dismutase [Cu-Zn] 1 OS=Brassica juncea GN=SODCC1 PE=2 SV=3 27 174 1.0E-42
sp|O49044|SODC2_MESCR Superoxide dismutase [Cu-Zn] 2 OS=Mesembryanthemum crystallinum GN=SODCC.2 PE=2 SV=1 27 174 1.0E-42
sp|P24707|SODCP_PINSY Superoxide dismutase [Cu-Zn], chloroplastic (Fragment) OS=Pinus sylvestris GN=SODCP PE=2 SV=1 39 174 4.0E-42
sp|Q9FK60|SODC3_ARATH Superoxide dismutase [Cu-Zn] 3 OS=Arabidopsis thaliana GN=CSD3 PE=1 SV=1 28 174 4.0E-42
sp|P80174|SODC_CARCR Superoxide dismutase [Cu-Zn] OS=Caretta caretta PE=1 SV=2 28 174 2.0E-40
sp|Q01137|SODC_SCHMA Superoxide dismutase [Cu-Zn] OS=Schistosoma mansoni GN=SOD PE=1 SV=1 28 174 2.0E-40
sp|Q54G70|SODC5_DICDI Superoxide dismutase [Cu-Zn] 5 OS=Dictyostelium discoideum GN=sodE PE=3 SV=1 28 174 3.0E-40
sp|Q90023|SODC_PBCV1 Superoxide dismutase [Cu-Zn] OS=Paramecium bursaria Chlorella virus 1 GN=A245R PE=3 SV=1 28 183 6.0E-40
sp|P24705|SODC_NPVAC Putative superoxide dismutase [Cu-Zn] OS=Autographa californica nuclear polyhedrosis virus GN=SOD PE=3 SV=1 28 174 8.0E-40
sp|P41974|SODE_DIRIM Extracellular superoxide dismutase [Cu-Zn] OS=Dirofilaria immitis PE=2 SV=1 29 173 5.0E-39
sp|Q54TU5|SODC4_DICDI Superoxide dismutase [Cu-Zn] 4 OS=Dictyostelium discoideum GN=sodD PE=2 SV=1 27 174 6.0E-37
sp|Q54TW8|SODC6_DICDI Probable superoxide dismutase [Cu-Zn] 6 OS=Dictyostelium discoideum GN=sodF PE=3 SV=1 27 174 6.0E-37
sp|O12933|SODC_NPVOP Putative superoxide dismutase [Cu-Zn] OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=SOD PE=3 SV=1 28 174 7.0E-36
sp|P81036|SODC_LAMCR Superoxide dismutase [Cu-Zn] (Fragment) OS=Lampanyctus crocodilus GN=sod1 PE=1 SV=2 27 172 2.0E-35
sp|Q95085|SODC_DROOB Superoxide dismutase [Cu-Zn] (Fragment) OS=Drosophila obscura GN=Sod PE=3 SV=1 34 148 3.0E-35
sp|Q95088|SODC_DROPE Superoxide dismutase [Cu-Zn] (Fragment) OS=Drosophila persimilis GN=Sod PE=3 SV=1 34 148 7.0E-35
sp|Q95087|SODC_DROPB Superoxide dismutase [Cu-Zn] (Fragment) OS=Drosophila pseudoobscura bogotana GN=Sod PE=3 SV=1 34 148 7.0E-35
sp|Q95079|SODC_DROMI Superoxide dismutase [Cu-Zn] (Fragment) OS=Drosophila miranda GN=Sod PE=3 SV=1 34 148 7.0E-35
sp|Q95081|SODC_DROMD Superoxide dismutase [Cu-Zn] (Fragment) OS=Drosophila madeirensis GN=Sod PE=3 SV=1 34 148 8.0E-35
sp|Q12548|SODC_ASPJA Superoxide dismutase [Cu-Zn] (Fragment) OS=Aspergillus japonicus GN=sodC PE=3 SV=1 70 167 2.0E-34
sp|P34461|SODE_CAEEL Extracellular superoxide dismutase [Cu-Zn] OS=Caenorhabditis elegans GN=sod-4 PE=1 SV=2 1 176 3.0E-34
sp|Q95095|SODC_DROTO Superoxide dismutase [Cu-Zn] (Fragment) OS=Drosophila tolteca GN=Sod PE=3 SV=1 34 148 1.0E-33
sp|P51547|SODE_HAECO Extracellular superoxide dismutase [Cu-Zn] OS=Haemonchus contortus GN=SOD PE=2 SV=1 19 176 2.0E-33
sp|Q9JK72|CCS_RAT Copper chaperone for superoxide dismutase OS=Rattus norvegicus GN=Ccs PE=1 SV=1 20 174 7.0E-29
sp|Q9WU84|CCS_MOUSE Copper chaperone for superoxide dismutase OS=Mus musculus GN=Ccs PE=1 SV=1 20 174 5.0E-28
sp|O14618|CCS_HUMAN Copper chaperone for superoxide dismutase OS=Homo sapiens GN=CCS PE=1 SV=1 30 174 9.0E-28
sp|Q6PWT7|CCS_PIG Copper chaperone for superoxide dismutase OS=Sus scrofa GN=CCS PE=2 SV=1 30 174 1.0E-25
sp|P16026|SODE_SCHMA Extracellular superoxide dismutase [Cu-Zn] OS=Schistosoma mansoni PE=2 SV=1 42 181 8.0E-25
sp|Q08420|SODE_RAT Extracellular superoxide dismutase [Cu-Zn] OS=Rattus norvegicus GN=Sod3 PE=1 SV=2 39 173 2.0E-21
sp|P08294|SODE_HUMAN Extracellular superoxide dismutase [Cu-Zn] OS=Homo sapiens GN=SOD3 PE=1 SV=2 39 173 3.0E-21
sp|P41975|SODE_RABIT Extracellular superoxide dismutase [Cu-Zn] OS=Oryctolagus cuniculus GN=SOD3 PE=2 SV=2 39 173 4.0E-21
sp|O09164|SODE_MOUSE Extracellular superoxide dismutase [Cu-Zn] OS=Mus musculus GN=Sod3 PE=1 SV=1 39 173 9.0E-21
sp|P36214|SODCP_POPTM Superoxide dismutase [Cu-Zn], chloroplastic OS=Populus tremuloides GN=SODCP PE=2 SV=1 103 174 4.0E-15
sp|O66602|SODC2_AQUAE Superoxide dismutase [Cu-Zn] 2 OS=Aquifex aeolicus (strain VF5) GN=sodC2 PE=3 SV=1 57 174 4.0E-13
sp|O67149|SODC1_AQUAE Superoxide dismutase [Cu-Zn] 1 OS=Aquifex aeolicus (strain VF5) GN=sodC1 PE=3 SV=1 5 174 2.0E-12
sp|Q9RU48|SODC_DEIRA Superoxide dismutase [Cu-Zn] OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=sodC PE=3 SV=1 19 176 3.0E-10
sp|Q59689|SODC_PASMU Superoxide dismutase [Cu-Zn] OS=Pasteurella multocida (strain Pm70) GN=sodC PE=3 SV=2 4 174 1.0E-07
sp|Q54RQ1|SODC3_DICDI Extracellular superoxide dismutase [Cu-Zn] 3 OS=Dictyostelium discoideum GN=sodC PE=2 SV=1 27 159 2.0E-07
sp|Q9LD47|CCS_ARATH Copper chaperone for superoxide dismutase, chloroplastic/cytosolic OS=Arabidopsis thaliana GN=CCS PE=1 SV=1 40 152 3.0E-07
sp|Q54RN1|SODC2_DICDI Extracellular superoxide dismutase [Cu-Zn] 2 OS=Dictyostelium discoideum GN=sodB PE=2 SV=1 67 152 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0006801 superoxide metabolic process Yes
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0072593 reactive oxygen species metabolic process No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0044237 cellular metabolic process No
GO:0043169 cation binding No
GO:0003674 molecular_function No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8885
MKSRALLAVLFASGVSCQCGEEKAPTMIRAVSVLRGDTKVSGTVVFEQESESAPTKITWNITGNDPKAQRGFHIH
AYGDHSDGCASAGPHFNPFNKKHGAPSDEERHVGDMGNIETDEQGVAQGTLTDSQIKLVGPDSVIGRSVVVHAGT
DDLGKGNHEESPLTGNAGGRPACGSFCHLKPHLAVEGWTFNMANVHRTRERDWDCE*
Coding >Hirsu2|8885
ATGAAATCCCGTGCTCTTTTAGCCGTCCTCTTCGCCTCGGGCGTTTCCTGCCAGTGCGGCGAAGAGAAAGCCCCA
ACAATGATCAGAGCAGTGTCTGTGCTCCGTGGCGACACAAAAGTCTCGGGTACCGTCGTTTTCGAGCAAGAATCC
GAGTCCGCGCCTACGAAAATCACATGGAACATTACCGGCAACGATCCGAAAGCACAGCGCGGTTTCCACATCCAT
GCGTACGGCGATCACAGCGATGGCTGCGCCTCGGCCGGGCCCCATTTCAACCCGTTCAACAAGAAACACGGCGCT
CCCAGCGACGAAGAGCGTCATGTCGGTGACATGGGCAATATTGAAACCGATGAACAAGGCGTTGCGCAAGGCACC
CTGACCGATTCTCAGATCAAGTTGGTCGGACCTGACAGCGTCATTGGTCGCTCTGTCGTCGTCCACGCAGGCACC
GATGACCTCGGAAAGGGGAACCACGAAGAGTCACCCTTGACGGGCAACGCCGGTGGGCGACCCGCCTGCGGTTCG
TTTTGTCACCTCAAACCGCATCTTGCTGTTGAGGGCTGGACCTTTAATATGGCAAATGTGCATCGAACCAGAGAG
CGCGACTGGGATTGCGAGTGA
Transcript >Hirsu2|8885
ATGAAATCCCGTGCTCTTTTAGCCGTCCTCTTCGCCTCGGGCGTTTCCTGCCAGTGCGGCGAAGAGAAAGCCCCA
ACAATGATCAGAGCAGTGTCTGTGCTCCGTGGCGACACAAAAGTCTCGGGTACCGTCGTTTTCGAGCAAGAATCC
GAGTCCGCGCCTACGAAAATCACATGGAACATTACCGGCAACGATCCGAAAGCACAGCGCGGTTTCCACATCCAT
GCGTACGGCGATCACAGCGATGGCTGCGCCTCGGCCGGGCCCCATTTCAACCCGTTCAACAAGAAACACGGCGCT
CCCAGCGACGAAGAGCGTCATGTCGGTGACATGGGCAATATTGAAACCGATGAACAAGGCGTTGCGCAAGGCACC
CTGACCGATTCTCAGATCAAGTTGGTCGGACCTGACAGCGTCATTGGTCGCTCTGTCGTCGTCCACGCAGGCACC
GATGACCTCGGAAAGGGGAACCACGAAGAGTCACCCTTGACGGGCAACGCCGGTGGGCGACCCGCCTGCGGTTCG
TTTTGTCACCTCAAACCGCATCTTGCTGTTGAGGGCTGGACCTTTAATATGGCAAATGTGCATCGAACCAGAGAG
CGCGACTGGGATTGCGAGTGA
Gene >Hirsu2|8885
ATGAAATCCCGTGCTCTTTTAGCCGTCCTCTTCGCCTCGGGCGTTTCCTGCCAGTGCGGCGAAGAGAAAGCCCCA
ACAATGATCAGAGCAGGTAGGTGCTGAAGTTTTCCCACAAGCAATCAAAAGCAGACCAAAGAGACCTATTATCGG
CACATGAAGTTTCGGGTCGGAACCCTCTTGGCAAATTCTTCTCGAGCGCTGGGAGTGAGGGAGTTGCCCAGCTTC
GGGCAACTACCTCCGTACATGTATTTATATGACCCTGGGATCGACTGATCTGCTATGTGGCTTAAGCCCAATCGA
CCTTCTTGCGGCCAATCTCCCGACCCTTGATAAGAAAGCACGCAGCATTCAAGTTTTACACACGCGTGTCTGTAT
ATGCATTGTCGTCACATTCCTGACAGGGCCCTTTTAGTGTCTGTGCTCCGTGGCGACACAAAAGTCTCGGGTACC
GTCGTTTTCGAGCAAGAATCCGAGTCCGCGCCTACGAAAATCACATGGAACATTACCGGCAACGATCCGAAAGCA
CAGCGCGGTTTCCACATCCATGCGTACGGCGATCACAGCGATGGCTGCGCCTCGGCCGGGCCCCATTGTCAGTCC
TCTCAACGTGTCGCCAGGATGCTCCGCTAACCTTACATGTCGCCTGGATCTGCAGTCAACCCGTTCAACAAGAAA
CACGGCGCTCCCAGCGACGAAGAGCGTCATGTCGGTGACATGGGCAATATTGAAACCGATGAACAAGGCGTTGCG
CAAGGCACCCTGACCGATTCTCAGATCAAGTTGGTCGGACCTGACAGCGTCATTGGTGTAAGTCCTCAAACGGCG
TTGATGCGGCGCTTTGGCGGCTGACCGGCTGCTCAGCGCTCTGTCGTCGTCCACGCAGGCACCGATGACCTCGGA
AAGGGGAACCACGAAGAGTCACCCTTGACGGGCAACGCCGGTGGGCGACCCGCCTGCGGTTCGTTTTGTCACCTC
AAACCGGTAAGTTACAGTTTCTAACAAGGTCACTGAAGGTGTGATTGGCACTGCCAAATGAAGCATCTTGCTGTT
GAGGGCTGGACCTTTAATATGGCAAATGTGCATCGAACCAGAGAGCGCGACTGGGATTGCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail