Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8884
Gene name
LocationContig_608:7648..9436
Strand-
Gene length (bp)1788
Transcript length (bp)1788
Coding sequence length (bp)1788
Protein length (aa) 596

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01301 Glyco_hydro_35 Glycosyl hydrolases family 35 8.9E-81 1 315
PF02449 Glyco_hydro_42 Beta-galactosidase 1.0E-09 3 143

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q58D55|BGAL_BOVIN Beta-galactosidase OS=Bos taurus GN=GLB1 PE=2 SV=1 5 569 5.0E-100
sp|Q60HF6|BGAL_MACFA Beta-galactosidase OS=Macaca fascicularis GN=GLB1 PE=2 SV=1 5 580 4.0E-99
sp|P16278|BGAL_HUMAN Beta-galactosidase OS=Homo sapiens GN=GLB1 PE=1 SV=2 5 582 2.0E-98
sp|Q9TRY9|BGAL_CANLF Beta-galactosidase OS=Canis lupus familiaris GN=GLB1 PE=2 SV=3 5 569 2.0E-98
sp|P48982|BGAL_XANMN Beta-galactosidase OS=Xanthomonas manihotis GN=bga PE=1 SV=1 4 549 4.0E-98
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q58D55|BGAL_BOVIN Beta-galactosidase OS=Bos taurus GN=GLB1 PE=2 SV=1 5 569 5.0E-100
sp|Q60HF6|BGAL_MACFA Beta-galactosidase OS=Macaca fascicularis GN=GLB1 PE=2 SV=1 5 580 4.0E-99
sp|P16278|BGAL_HUMAN Beta-galactosidase OS=Homo sapiens GN=GLB1 PE=1 SV=2 5 582 2.0E-98
sp|Q9TRY9|BGAL_CANLF Beta-galactosidase OS=Canis lupus familiaris GN=GLB1 PE=2 SV=3 5 569 2.0E-98
sp|P48982|BGAL_XANMN Beta-galactosidase OS=Xanthomonas manihotis GN=bga PE=1 SV=1 4 549 4.0E-98
sp|Q5R7P4|BGAL_PONAB Beta-galactosidase OS=Pongo abelii GN=GLB1 PE=2 SV=1 5 569 3.0E-97
sp|O19015|BGAL_FELCA Beta-galactosidase OS=Felis catus GN=GLB1 PE=2 SV=1 5 590 3.0E-97
sp|Q8NCI6|GLBL3_HUMAN Beta-galactosidase-1-like protein 3 OS=Homo sapiens GN=GLB1L3 PE=2 SV=3 5 567 7.0E-97
sp|Q3UPY5|GLBL2_MOUSE Beta-galactosidase-1-like protein 2 OS=Mus musculus GN=Glb1l2 PE=1 SV=1 5 567 8.0E-96
sp|P23780|BGAL_MOUSE Beta-galactosidase OS=Mus musculus GN=Glb1 PE=1 SV=1 5 569 9.0E-94
sp|Q8IW92|GLBL2_HUMAN Beta-galactosidase-1-like protein 2 OS=Homo sapiens GN=GLB1L2 PE=2 SV=1 5 567 2.0E-93
sp|Q5XIL5|GLBL3_RAT Beta-galactosidase-1-like protein 3 OS=Rattus norvegicus GN=Glb1l3 PE=2 SV=1 5 567 9.0E-86
sp|Q95LV1|GLB1L_MACFA Beta-galactosidase-1-like protein OS=Macaca fascicularis GN=GLB1L PE=2 SV=1 5 569 1.0E-84
sp|Q6UWU2|GLB1L_HUMAN Beta-galactosidase-1-like protein OS=Homo sapiens GN=GLB1L PE=2 SV=1 5 569 7.0E-84
sp|Q54GE1|BGAL1_DICDI Beta-galactosidase 1 OS=Dictyostelium discoideum GN=glb1 PE=3 SV=1 11 567 7.0E-84
sp|A2RSQ1|GLBL3_MOUSE Beta-galactosidase-1-like protein 3 OS=Mus musculus GN=Glb1l3 PE=1 SV=1 5 567 3.0E-83
sp|Q8VC60|GLB1L_MOUSE Beta-galactosidase-1-like protein OS=Mus musculus GN=Glb1l PE=1 SV=1 5 569 5.0E-83
sp|Q0DGD7|BGAL8_ORYSJ Beta-galactosidase 8 OS=Oryza sativa subsp. japonica GN=Os05g0539400 PE=2 SV=1 5 569 2.0E-81
sp|Q93Z24|BGA17_ARATH Beta-galactosidase 17 OS=Arabidopsis thaliana GN=BGAL17 PE=2 SV=1 5 569 2.0E-75
sp|A2X2H7|BGAL4_ORYSI Beta-galactosidase 4 OS=Oryza sativa subsp. indica GN=OsI_006270 PE=3 SV=1 3 540 5.0E-36
sp|Q6Z6K4|BGAL4_ORYSJ Beta-galactosidase 4 OS=Oryza sativa subsp. japonica GN=Os02g0219200 PE=2 SV=1 3 540 7.0E-36
sp|Q9MAJ7|BGAL5_ARATH Beta-galactosidase 5 OS=Arabidopsis thaliana GN=BGAL5 PE=2 SV=1 3 559 2.0E-35
sp|Q7G3T8|BGA13_ORYSJ Beta-galactosidase 13 OS=Oryza sativa subsp. japonica GN=Os10g0330600 PE=2 SV=1 3 301 1.0E-33
sp|P45582|BGAL_ASPOF Beta-galactosidase OS=Asparagus officinalis PE=2 SV=1 3 300 2.0E-33
sp|Q10RB4|BGAL5_ORYSJ Beta-galactosidase 5 OS=Oryza sativa subsp. japonica GN=Os03g0165400 PE=2 SV=1 3 334 2.0E-33
sp|Q8RUV9|BGAL1_ORYSJ Beta-galactosidase 1 OS=Oryza sativa subsp. japonica GN=Os01g0533400 PE=2 SV=1 3 301 4.0E-33
sp|Q7XFK2|BGA14_ORYSJ Beta-galactosidase 14 OS=Oryza sativa subsp. japonica GN=Os10g0340600 PE=2 SV=1 3 301 6.0E-33
sp|Q9SCV4|BGAL8_ARATH Beta-galactosidase 8 OS=Arabidopsis thaliana GN=BGAL8 PE=2 SV=2 3 300 1.0E-32
sp|Q9SCV9|BGAL3_ARATH Beta-galactosidase 3 OS=Arabidopsis thaliana GN=BGAL3 PE=1 SV=1 11 300 1.0E-31
sp|Q9SCW1|BGAL1_ARATH Beta-galactosidase 1 OS=Arabidopsis thaliana GN=BGAL1 PE=1 SV=1 3 300 2.0E-31
sp|Q9SCV3|BGAL9_ARATH Beta-galactosidase 9 OS=Arabidopsis thaliana GN=BGAL9 PE=2 SV=1 3 304 2.0E-31
sp|Q00662|BGAL_DIACA Putative beta-galactosidase OS=Dianthus caryophyllus GN=CARSR12 PE=2 SV=1 3 304 3.0E-31
sp|Q9SCV0|BGA12_ARATH Beta-galactosidase 12 OS=Arabidopsis thaliana GN=BGAL12 PE=2 SV=1 3 304 4.0E-31
sp|P49676|BGAL_BRAOL Beta-galactosidase OS=Brassica oleracea PE=2 SV=1 11 301 5.0E-31
sp|Q10NX8|BGAL6_ORYSJ Beta-galactosidase 6 OS=Oryza sativa subsp. japonica GN=Os03g0255100 PE=1 SV=2 11 300 1.0E-30
sp|Q9SCV5|BGAL7_ARATH Beta-galactosidase 7 OS=Arabidopsis thaliana GN=BGAL7 PE=2 SV=2 11 301 1.0E-30
sp|Q9C6W4|BGA15_ARATH Beta-galactosidase 15 OS=Arabidopsis thaliana GN=BGAL15 PE=2 SV=1 5 301 2.0E-30
sp|P48981|BGAL_MALDO Beta-galactosidase OS=Malus domestica PE=1 SV=1 3 304 4.0E-30
sp|Q75HQ3|BGAL7_ORYSJ Beta-galactosidase 7 OS=Oryza sativa subsp. japonica GN=Os05g0428100 PE=3 SV=1 11 548 9.0E-30
sp|Q9FN08|BGA10_ARATH Beta-galactosidase 10 OS=Arabidopsis thaliana GN=BGAL10 PE=2 SV=1 3 302 1.0E-29
sp|Q9SCU8|BGA14_ARATH Beta-galactosidase 14 OS=Arabidopsis thaliana GN=BGAL14 PE=2 SV=2 3 300 1.0E-29
sp|Q9SCV8|BGAL4_ARATH Beta-galactosidase 4 OS=Arabidopsis thaliana GN=BGAL4 PE=1 SV=1 3 312 1.0E-29
sp|Q5Z7L0|BGAL9_ORYSJ Beta-galactosidase 9 OS=Oryza sativa subsp. japonica GN=Os06g0573600 PE=2 SV=1 3 300 1.0E-29
sp|Q8GX69|BGA16_ARATH Beta-galactosidase 16 OS=Arabidopsis thaliana GN=BGAL16 PE=2 SV=2 11 300 3.0E-29
sp|Q9SCU9|BGA13_ARATH Beta-galactosidase 13 OS=Arabidopsis thaliana GN=BGAL13 PE=2 SV=1 3 304 7.0E-29
sp|P48980|BGAL_SOLLC Beta-galactosidase OS=Solanum lycopersicum PE=1 SV=1 3 300 1.0E-28
sp|Q8W0A1|BGAL2_ORYSJ Beta-galactosidase 2 OS=Oryza sativa subsp. japonica GN=Os01g0580200 PE=2 SV=1 3 300 2.0E-28
sp|Q9SCV1|BGA11_ARATH Beta-galactosidase 11 OS=Arabidopsis thaliana GN=BGAL11 PE=2 SV=1 3 304 3.0E-28
sp|Q9LFA6|BGAL2_ARATH Beta-galactosidase 2 OS=Arabidopsis thaliana GN=BGAL2 PE=2 SV=2 3 300 1.0E-27
sp|Q67VU7|BGA10_ORYSJ Putative beta-galactosidase 10 OS=Oryza sativa subsp. japonica GN=Os06g0628500 PE=3 SV=1 3 301 3.0E-27
sp|Q0INM3|BGA15_ORYSJ Beta-galactosidase 15 OS=Oryza sativa subsp. japonica GN=Os12g0429200 PE=2 SV=1 3 300 5.0E-27
sp|Q54MV6|BGAL2_DICDI Probable beta-galactosidase 2 OS=Dictyostelium discoideum GN=glb2 PE=3 SV=1 5 386 4.0E-26
sp|Q0IZZ8|BGA12_ORYSJ Beta-galactosidase 12 OS=Oryza sativa subsp. japonica GN=Os09g0539200 PE=2 SV=2 5 319 6.0E-26
sp|Q5N8X6|BGAL3_ORYSJ Beta-galactosidase 3 OS=Oryza sativa subsp. japonica GN=Os01g0875500 PE=3 SV=1 3 300 3.0E-25
sp|Q6ZJJ0|BGA11_ORYSJ Beta-galactosidase 11 OS=Oryza sativa subsp. japonica GN=Os08g0549200 PE=2 SV=1 5 300 1.0E-24
sp|Q9FFN4|BGAL6_ARATH Beta-galactosidase 6 OS=Arabidopsis thaliana GN=BGAL6 PE=2 SV=1 3 300 2.0E-24
sp|Q5BFC4|BGALA_EMENI Probable beta-galactosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lacA PE=3 SV=2 1 312 5.0E-23
sp|P29853|BGAL_ASPNG Beta-galactosidase OS=Aspergillus niger GN=lacA PE=1 SV=2 15 312 2.0E-22
sp|Q4WS33|BGALA_ASPFU Probable beta-galactosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lacA PE=3 SV=2 1 319 4.0E-22
sp|B0XMP7|BGALA_ASPFC Probable beta-galactosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=lacA PE=3 SV=2 1 319 5.0E-22
sp|A2QAN3|BGALA_ASPNC Probable beta-galactosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=lacA PE=3 SV=1 15 312 7.0E-22
sp|A1D1Z9|BGALA_NEOFI Probable beta-galactosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=lacA PE=3 SV=1 1 319 2.0E-21
sp|Q4ZHV7|BGALA_ASPPH Probable beta-galactosidase A OS=Aspergillus phoenicis GN=lacA PE=2 SV=1 15 312 2.0E-21
sp|Q700S9|BGALA_PENSQ Probable beta-galactosidase A OS=Penicillium sp. GN=lacA PE=1 SV=1 1 312 3.0E-20
sp|Q2UCU3|BGALA_ASPOR Probable beta-galactosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lacA PE=1 SV=1 1 319 4.0E-20
sp|B8N6V7|BGALA_ASPFN Probable beta-galactosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=lacA PE=3 SV=1 1 319 4.0E-20
sp|A2QL84|BGALC_ASPNC Probable beta-galactosidase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=lacC PE=3 SV=1 11 299 5.0E-20
sp|B8QGZ3|BGALA_PENEN Probable beta-galactosidase A OS=Penicillium expansum GN=lacA PE=2 SV=1 1 312 7.0E-20
sp|A1DM65|BGALC_NEOFI Probable beta-galactosidase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=lacC PE=3 SV=1 4 299 1.0E-19
sp|A2QA64|BGALB_ASPNC Probable beta-galactosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=lacB PE=3 SV=2 5 312 2.0E-19
sp|B8NKI4|BGALB_ASPFN Probable beta-galactosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=lacB PE=3 SV=2 5 350 3.0E-19
sp|B0Y752|BGALC_ASPFC Probable beta-galactosidase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=lacC PE=3 SV=1 4 299 6.0E-19
sp|Q4WNE4|BGALC_ASPFU Probable beta-galactosidase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lacC PE=3 SV=1 4 299 6.0E-19
sp|Q4WRD3|BGALB_ASPFU Probable beta-galactosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lacB PE=3 SV=1 5 298 2.0E-18
sp|B0XNY2|BGALB_ASPFC Probable beta-galactosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=lacB PE=3 SV=1 5 298 2.0E-18
sp|A7EZS5|BGALC_SCLS1 Probable beta-galactosidase C OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=lacC PE=3 SV=1 4 299 3.0E-18
sp|Q2U6P1|BGALB_ASPOR Probable beta-galactosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lacB PE=3 SV=2 5 350 4.0E-18
sp|B2W791|BGALB_PYRTR Probable beta-galactosidase B OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=lacB PE=3 SV=1 5 299 6.0E-18
sp|B8N2I5|BGALC_ASPFN Probable beta-galactosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=lacC PE=3 SV=1 4 299 9.0E-18
sp|Q2UMD5|BGALC_ASPOR Probable beta-galactosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lacC PE=3 SV=1 4 299 1.0E-17
sp|B6QLF0|BGALB_TALMQ Probable beta-galactosidase B OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=lacB PE=3 SV=1 5 315 2.0E-17
sp|A1D199|BGALB_NEOFI Probable beta-galactosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=lacB PE=3 SV=1 5 298 2.0E-17
sp|A1DJ58|BGALE_NEOFI Probable beta-galactosidase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=lacE PE=3 SV=1 1 298 1.0E-16
sp|A1CE56|BGALC_ASPCL Probable beta-galactosidase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=lacC PE=3 SV=1 4 299 1.0E-16
sp|A6RPN7|BGALB_BOTFB Probable beta-galactosidase B OS=Botryotinia fuckeliana (strain B05.10) GN=lacB PE=3 SV=1 5 299 2.0E-16
sp|Q4WG05|BGALE_ASPFU Probable beta-galactosidase E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lacE PE=3 SV=1 1 298 2.0E-16
sp|B0XXE7|BGALE_ASPFC Probable beta-galactosidase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=lacE PE=3 SV=1 1 298 2.0E-16
sp|Q0CMF3|BGALB_ASPTN Probable beta-galactosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lacB PE=3 SV=2 5 350 3.0E-16
sp|A7EBU5|BGALB_SCLS1 Probable beta-galactosidase B OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=lacB PE=3 SV=1 5 299 5.0E-16
sp|Q5BEQ0|BGALB_EMENI Probable beta-galactosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lacB PE=3 SV=2 5 315 7.0E-16
sp|B6QHA9|BGALC_TALMQ Probable beta-galactosidase C OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=lacC PE=3 SV=1 11 299 1.0E-14
sp|B6GW04|BGALB_PENRW Probable beta-galactosidase B OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=lacB PE=3 SV=2 5 413 2.0E-13
sp|B6H5X9|BGALC_PENRW Probable beta-galactosidase C OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=lacC PE=3 SV=1 4 299 8.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0004565 beta-galactosidase activity Yes
GO:0009341 beta-galactosidase complex Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0015925 galactosidase activity No
GO:0071704 organic substance metabolic process No
GO:1902494 catalytic complex No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0032991 protein-containing complex No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0044238 primary metabolic process No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5065 0.3384 0.3833 0.1863 0.2905 0.0219 0.1395 0.433 0.1557 0.0112

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH35 7.6E-87 2 314

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6787
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|01605
Ophiocordyceps camponoti-rufipedis Ophun1|1575
Ophiocordyceps kimflemingae Ophio5|6819
Ophiocordyceps subramaniannii Hirsu2|8884 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8884
MDPQRIPQAYWRQRLRMARAMGLNTVFSYVFWNELEPARGRWDFSGRNDVARFFRIADEEGLKVVLRPGPYVCGE
REWGGFPAWLMMATGGGGDEPVRVREDNGPFLEASRRYLRRLGAELRDLQATRGGPVLMVQLENEYGSFGSDKKY
LQALADMLRESFDLRLYTNDGDNKANLENGQLHGVLAETDGDPRQGFAARDKYVTDKTSLGPQLDGEYYVTWFDD
WSASSGHHAAPGNGAAVDKALDGLEWVLRGNNSFSIYMFHGGTNWGFGNGAIWANGRTMAVTSSYDYGAPLDESG
RPTEIYFKLRAMISKYVPAGSIPEVPKTPPLIDIKEFSLKPARPLFDTRSRQPDKRSSQPATMESLAQSYGFVLY
EHKVAEDASGILSPGDEPRDRVMVYVNGKRVGVVDRTYVTPAKVRLSLKRGDTLQLLVENLGRVDFTHKLKDQRK
GIVGNVSLGSGRVLEGWSMYSLSLDALPPGIFTNSQVVVRDEQPPVFYTASFRLPAGSKTGFESDTFLSLPRGTK
GQVWVNGINLGRYWAVGPQQSLYLPGCYLKTAGQPNEVVVLELEPRASAPPSAKGISVRQWFNSPDPDAP*
Coding >Hirsu2|8884
ATGGATCCGCAGCGCATCCCGCAAGCCTACTGGCGGCAGCGGCTGCGGATGGCGCGAGCCATGGGCCTCAACACC
GTCTTCAGCTACGTCTTCTGGAACGAGCTGGAGCCGGCGCGCGGTCGGTGGGACTTCAGCGGCCGCAACGACGTC
GCCCGCTTCTTCCGCATCGCCGACGAGGAGGGCCTCAAGGTCGTGCTCCGGCCCGGGCCGTACGTCTGCGGCGAG
CGCGAATGGGGCGGCTTTCCCGCCTGGCTGATGATGGCCACGGGCGGCGGCGGCGACGAGCCCGTCCGGGTCCGG
GAGGACAACGGGCCTTTCCTGGAGGCGTCGCGGCGATACCTCCGCCGGCTCGGCGCCGAGCTGCGCGACTTGCAG
GCCACGCGCGGCGGGCCCGTCCTGATGGTCCAGCTGGAGAACGAGTACGGCAGCTTCGGCAGCGACAAGAAGTAC
CTGCAGGCCCTGGCCGACATGCTGCGCGAGAGCTTCGACCTGCGCCTCTACACCAACGACGGCGACAACAAGGCC
AACCTCGAGAACGGGCAGCTGCACGGCGTCCTGGCCGAGACGGACGGCGATCCCAGGCAGGGCTTCGCCGCCCGC
GACAAGTACGTGACCGACAAGACCAGCCTCGGGCCCCAGCTCGACGGTGAGTACTACGTCACCTGGTTCGACGAC
TGGTCGGCCTCGTCGGGCCACCACGCCGCGCCCGGGAACGGGGCGGCCGTGGACAAGGCCCTCGACGGCCTCGAG
TGGGTGCTTCGCGGCAACAACTCGTTCAGCATCTACATGTTCCACGGCGGCACCAACTGGGGCTTCGGCAACGGC
GCCATCTGGGCCAACGGCCGCACCATGGCCGTCACGTCGAGCTACGACTACGGCGCCCCCCTGGACGAGTCGGGC
CGGCCGACCGAGATCTACTTCAAGCTTCGCGCCATGATCTCCAAATACGTCCCCGCCGGCAGCATACCCGAGGTG
CCGAAAACACCCCCGCTGATCGATATCAAAGAGTTCTCTCTGAAGCCGGCCCGGCCGCTCTTTGACACCCGCTCA
CGTCAGCCTGACAAGAGGTCCTCCCAGCCGGCTACCATGGAGTCTCTGGCCCAGTCTTACGGCTTCGTCTTATAC
GAGCACAAAGTAGCCGAGGACGCCAGCGGCATCCTGAGTCCGGGAGACGAGCCTCGGGACAGAGTCATGGTGTAC
GTGAACGGCAAACGGGTGGGCGTCGTCGACAGGACGTACGTCACTCCAGCCAAGGTACGGCTGTCCCTGAAACGG
GGCGACACTCTGCAGCTTCTTGTCGAGAACCTCGGCCGCGTCGACTTCACCCATAAGCTCAAGGATCAGCGCAAG
GGTATCGTCGGCAACGTCAGCCTCGGCAGCGGCCGGGTGCTGGAAGGGTGGTCGATGTACTCTCTCTCTCTGGAT
GCCCTGCCGCCCGGGATCTTCACGAACAGCCAGGTCGTTGTTCGGGATGAGCAGCCGCCAGTTTTTTACACCGCA
TCGTTCCGGCTTCCAGCCGGTTCCAAGACTGGCTTCGAAAGCGACACCTTTCTGTCACTGCCACGGGGCACCAAG
GGCCAGGTCTGGGTCAACGGAATCAACTTGGGCCGATACTGGGCCGTGGGACCCCAACAAAGCCTCTACCTCCCG
GGCTGCTATCTGAAGACTGCTGGACAGCCCAATGAAGTCGTGGTATTGGAGCTTGAGCCGCGCGCTTCTGCCCCT
CCCTCCGCCAAGGGCATCTCCGTGAGACAATGGTTTAACAGTCCAGATCCGGATGCCCCGTGA
Transcript >Hirsu2|8884
ATGGATCCGCAGCGCATCCCGCAAGCCTACTGGCGGCAGCGGCTGCGGATGGCGCGAGCCATGGGCCTCAACACC
GTCTTCAGCTACGTCTTCTGGAACGAGCTGGAGCCGGCGCGCGGTCGGTGGGACTTCAGCGGCCGCAACGACGTC
GCCCGCTTCTTCCGCATCGCCGACGAGGAGGGCCTCAAGGTCGTGCTCCGGCCCGGGCCGTACGTCTGCGGCGAG
CGCGAATGGGGCGGCTTTCCCGCCTGGCTGATGATGGCCACGGGCGGCGGCGGCGACGAGCCCGTCCGGGTCCGG
GAGGACAACGGGCCTTTCCTGGAGGCGTCGCGGCGATACCTCCGCCGGCTCGGCGCCGAGCTGCGCGACTTGCAG
GCCACGCGCGGCGGGCCCGTCCTGATGGTCCAGCTGGAGAACGAGTACGGCAGCTTCGGCAGCGACAAGAAGTAC
CTGCAGGCCCTGGCCGACATGCTGCGCGAGAGCTTCGACCTGCGCCTCTACACCAACGACGGCGACAACAAGGCC
AACCTCGAGAACGGGCAGCTGCACGGCGTCCTGGCCGAGACGGACGGCGATCCCAGGCAGGGCTTCGCCGCCCGC
GACAAGTACGTGACCGACAAGACCAGCCTCGGGCCCCAGCTCGACGGTGAGTACTACGTCACCTGGTTCGACGAC
TGGTCGGCCTCGTCGGGCCACCACGCCGCGCCCGGGAACGGGGCGGCCGTGGACAAGGCCCTCGACGGCCTCGAG
TGGGTGCTTCGCGGCAACAACTCGTTCAGCATCTACATGTTCCACGGCGGCACCAACTGGGGCTTCGGCAACGGC
GCCATCTGGGCCAACGGCCGCACCATGGCCGTCACGTCGAGCTACGACTACGGCGCCCCCCTGGACGAGTCGGGC
CGGCCGACCGAGATCTACTTCAAGCTTCGCGCCATGATCTCCAAATACGTCCCCGCCGGCAGCATACCCGAGGTG
CCGAAAACACCCCCGCTGATCGATATCAAAGAGTTCTCTCTGAAGCCGGCCCGGCCGCTCTTTGACACCCGCTCA
CGTCAGCCTGACAAGAGGTCCTCCCAGCCGGCTACCATGGAGTCTCTGGCCCAGTCTTACGGCTTCGTCTTATAC
GAGCACAAAGTAGCCGAGGACGCCAGCGGCATCCTGAGTCCGGGAGACGAGCCTCGGGACAGAGTCATGGTGTAC
GTGAACGGCAAACGGGTGGGCGTCGTCGACAGGACGTACGTCACTCCAGCCAAGGTACGGCTGTCCCTGAAACGG
GGCGACACTCTGCAGCTTCTTGTCGAGAACCTCGGCCGCGTCGACTTCACCCATAAGCTCAAGGATCAGCGCAAG
GGTATCGTCGGCAACGTCAGCCTCGGCAGCGGCCGGGTGCTGGAAGGGTGGTCGATGTACTCTCTCTCTCTGGAT
GCCCTGCCGCCCGGGATCTTCACGAACAGCCAGGTCGTTGTTCGGGATGAGCAGCCGCCAGTTTTTTACACCGCA
TCGTTCCGGCTTCCAGCCGGTTCCAAGACTGGCTTCGAAAGCGACACCTTTCTGTCACTGCCACGGGGCACCAAG
GGCCAGGTCTGGGTCAACGGAATCAACTTGGGCCGATACTGGGCCGTGGGACCCCAACAAAGCCTCTACCTCCCG
GGCTGCTATCTGAAGACTGCTGGACAGCCCAATGAAGTCGTGGTATTGGAGCTTGAGCCGCGCGCTTCTGCCCCT
CCCTCCGCCAAGGGCATCTCCGTGAGACAATGGTTTAACAGTCCAGATCCGGATGCCCCGTGA
Gene >Hirsu2|8884
ATGGATCCGCAGCGCATCCCGCAAGCCTACTGGCGGCAGCGGCTGCGGATGGCGCGAGCCATGGGCCTCAACACC
GTCTTCAGCTACGTCTTCTGGAACGAGCTGGAGCCGGCGCGCGGTCGGTGGGACTTCAGCGGCCGCAACGACGTC
GCCCGCTTCTTCCGCATCGCCGACGAGGAGGGCCTCAAGGTCGTGCTCCGGCCCGGGCCGTACGTCTGCGGCGAG
CGCGAATGGGGCGGCTTTCCCGCCTGGCTGATGATGGCCACGGGCGGCGGCGGCGACGAGCCCGTCCGGGTCCGG
GAGGACAACGGGCCTTTCCTGGAGGCGTCGCGGCGATACCTCCGCCGGCTCGGCGCCGAGCTGCGCGACTTGCAG
GCCACGCGCGGCGGGCCCGTCCTGATGGTCCAGCTGGAGAACGAGTACGGCAGCTTCGGCAGCGACAAGAAGTAC
CTGCAGGCCCTGGCCGACATGCTGCGCGAGAGCTTCGACCTGCGCCTCTACACCAACGACGGCGACAACAAGGCC
AACCTCGAGAACGGGCAGCTGCACGGCGTCCTGGCCGAGACGGACGGCGATCCCAGGCAGGGCTTCGCCGCCCGC
GACAAGTACGTGACCGACAAGACCAGCCTCGGGCCCCAGCTCGACGGTGAGTACTACGTCACCTGGTTCGACGAC
TGGTCGGCCTCGTCGGGCCACCACGCCGCGCCCGGGAACGGGGCGGCCGTGGACAAGGCCCTCGACGGCCTCGAG
TGGGTGCTTCGCGGCAACAACTCGTTCAGCATCTACATGTTCCACGGCGGCACCAACTGGGGCTTCGGCAACGGC
GCCATCTGGGCCAACGGCCGCACCATGGCCGTCACGTCGAGCTACGACTACGGCGCCCCCCTGGACGAGTCGGGC
CGGCCGACCGAGATCTACTTCAAGCTTCGCGCCATGATCTCCAAATACGTCCCCGCCGGCAGCATACCCGAGGTG
CCGAAAACACCCCCGCTGATCGATATCAAAGAGTTCTCTCTGAAGCCGGCCCGGCCGCTCTTTGACACCCGCTCA
CGTCAGCCTGACAAGAGGTCCTCCCAGCCGGCTACCATGGAGTCTCTGGCCCAGTCTTACGGCTTCGTCTTATAC
GAGCACAAAGTAGCCGAGGACGCCAGCGGCATCCTGAGTCCGGGAGACGAGCCTCGGGACAGAGTCATGGTGTAC
GTGAACGGCAAACGGGTGGGCGTCGTCGACAGGACGTACGTCACTCCAGCCAAGGTACGGCTGTCCCTGAAACGG
GGCGACACTCTGCAGCTTCTTGTCGAGAACCTCGGCCGCGTCGACTTCACCCATAAGCTCAAGGATCAGCGCAAG
GGTATCGTCGGCAACGTCAGCCTCGGCAGCGGCCGGGTGCTGGAAGGGTGGTCGATGTACTCTCTCTCTCTGGAT
GCCCTGCCGCCCGGGATCTTCACGAACAGCCAGGTCGTTGTTCGGGATGAGCAGCCGCCAGTTTTTTACACCGCA
TCGTTCCGGCTTCCAGCCGGTTCCAAGACTGGCTTCGAAAGCGACACCTTTCTGTCACTGCCACGGGGCACCAAG
GGCCAGGTCTGGGTCAACGGAATCAACTTGGGCCGATACTGGGCCGTGGGACCCCAACAAAGCCTCTACCTCCCG
GGCTGCTATCTGAAGACTGCTGGACAGCCCAATGAAGTCGTGGTATTGGAGCTTGAGCCGCGCGCTTCTGCCCCT
CCCTCCGCCAAGGGCATCTCCGTGAGACAATGGTTTAACAGTCCAGATCCGGATGCCCCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail