Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8883
Gene name
LocationContig_608:5789..7458
Strand+
Gene length (bp)1669
Transcript length (bp)1542
Coding sequence length (bp)1542
Protein length (aa) 514

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 7.9E-36 67 435

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 52 488 9.0E-48
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 48 444 3.0E-46
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 51 363 1.0E-43
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 1 423 1.0E-40
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 21 497 2.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 52 488 9.0E-48
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 48 444 3.0E-46
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 51 363 1.0E-43
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 1 423 1.0E-40
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 21 497 2.0E-40
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 52 503 2.0E-34
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 50 433 3.0E-32
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 35 428 2.0E-31
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 45 512 3.0E-30
sp|Q88FY6|NICT_PSEPK Putative metabolite transport protein NicT OS=Pseudomonas putida (strain KT2440) GN=nicT PE=2 SV=1 40 371 2.0E-27
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 57 482 1.0E-26
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 42 336 7.0E-25
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 52 458 2.0E-23
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 18 511 3.0E-23
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 52 429 9.0E-22
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 52 509 2.0E-21
sp|Q05181|PHT1_PSEPU Phthalate transporter OS=Pseudomonas putida GN=pht1 PE=3 SV=1 53 372 7.0E-21
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 42 503 4.0E-20
sp|P53241|VHT1_YEAST Vitamin H transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHT1 PE=1 SV=1 48 280 3.0E-19
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 44 336 5.0E-19
sp|Q9C0U9|YQD3_SCHPO Uncharacterized transporter PB1C11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.03 PE=1 SV=1 44 501 4.0E-18
sp|O13880|VHT1_SCHPO Vitamin H transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vht1 PE=2 SV=1 53 502 4.0E-17
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 21 341 5.0E-15
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 40 512 9.0E-15
sp|Q12235|YCT1_YEAST High affinity cysteine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCT1 PE=1 SV=1 39 284 2.0E-13
sp|P39398|LGOT_ECOLI Probable L-galactonate transporter OS=Escherichia coli (strain K12) GN=lgoT PE=1 SV=2 36 240 4.0E-13
sp|P37489|YYBO_BACSU Uncharacterized transporter YybO OS=Bacillus subtilis (strain 168) GN=yybO PE=3 SV=1 52 358 2.0E-11
sp|P0CF20|YO163_YEAST Putative uncharacterized transporter YOL163W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL163W PE=5 SV=1 135 296 3.0E-11
sp|Q0K843|SAUU_CUPNH Probable sulfoacetate transporter SauU OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauU PE=2 SV=1 55 358 9.0E-10
sp|P0AA80|GARP_ECOLI Probable galactarate transporter OS=Escherichia coli (strain K12) GN=garP PE=1 SV=1 56 285 1.0E-09
sp|P0AA81|GARP_ECO57 Probable galactarate transporter OS=Escherichia coli O157:H7 GN=garP PE=3 SV=1 56 285 1.0E-09
sp|P42205|GUDP_PSEPU Probable glucarate transporter OS=Pseudomonas putida GN=gudP PE=3 SV=1 68 192 5.0E-09
sp|Q46916|GUDP_ECOLI Probable glucarate transporter OS=Escherichia coli (strain K12) GN=gudP PE=1 SV=1 49 259 1.0E-07
sp|P42237|GUDP_BACSU Probable glucarate transporter OS=Bacillus subtilis (strain 168) GN=gudP PE=3 SV=2 57 239 1.0E-06
sp|Q6NMN6|SPNS1_ARATH Probable sphingolipid transporter spinster homolog 1 OS=Arabidopsis thaliana GN=At5g65687 PE=1 SV=1 44 280 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

Domain # Start End Length
1 63 80 17
2 100 122 22
3 129 151 22
4 155 177 22
5 190 212 22
6 222 244 22
7 296 318 22
8 328 350 22
9 362 384 22
10 388 410 22
11 417 439 22
12 449 467 18

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8883
MSSDDIARAQGGAFDGPPDGEKHFVQKLEHADLPSSPAQNHEMDPARRASVERRMKRKLDARCAIFVLIYIMNYL
DRQTISAARLKGLQDDLKLDNTQYATCLSILYVGYILMQVPSNMVINRIQRPSLYIAGAMTLWGLISTLSGIAQD
FASMVVIRFFLGFVEAAFLPGALLLLSKWYTRRELTTRNAILFCGNLISNAFSALVGAGVLSNMQGVLGHAAWRW
LFFIEGAATMAIAIGAAFILPDLPHNTRGFSEEERFVAQLRMTEDVGEADTDSAEQGAFAGLMMALRDVKIYVLM
LTFTAYVVGLSFNAFFPTLTGTLGFDYVPTLLLSSPPWVFSCIISVLVSWHSDRTQEKFWHIIGPLILGIVGFVI
SMSTLNVAARYVALFLQAGSYAGYIVFYSWISSSFPRPPAKRAVAIAMINAFSQLGNVAGSYVWDLKDNGYRKSY
GIVLAMFCVAAVGSWVFKTMLGRLNEKLEENERRDGSDQSAEAEFIESSDEALRMRKGFRYLT*
Coding >Hirsu2|8883
ATGTCCAGCGACGACATCGCCCGGGCGCAGGGCGGCGCTTTCGACGGGCCTCCAGACGGCGAGAAGCACTTCGTC
CAGAAGCTCGAACACGCCGACCTCCCCTCGTCGCCAGCCCAGAATCACGAGATGGATCCGGCGCGGCGAGCCAGC
GTCGAGCGGCGCATGAAGCGCAAGCTCGATGCTCGCTGTGCCATCTTCGTCCTCATCTACATCATGAACTACCTC
GACCGCCAGACCATCTCGGCCGCGAGACTCAAGGGCCTGCAGGACGACCTGAAGCTCGACAACACCCAGTACGCG
ACGTGTCTCAGCATCCTCTACGTCGGCTACATCCTCATGCAGGTGCCGTCCAACATGGTCATCAACCGCATCCAG
CGACCGTCGCTCTACATCGCCGGCGCCATGACGCTCTGGGGCCTCATCAGCACGCTGAGCGGCATTGCACAGGAC
TTCGCCTCCATGGTCGTCATCCGCTTCTTCTTGGGCTTCGTCGAGGCAGCCTTCCTGCCCGGAGCCCTGCTGCTT
CTCTCCAAATGGTACACGCGCCGTGAGCTGACGACCCGAAACGCCATCCTCTTCTGCGGCAACCTCATCTCCAAC
GCCTTCTCCGCCCTTGTTGGCGCCGGGGTGCTCTCCAACATGCAGGGCGTTCTGGGCCATGCCGCGTGGAGATGG
CTTTTCTTCATCGAAGGCGCCGCAACCATGGCCATTGCGATTGGGGCCGCCTTTATTCTCCCGGACCTGCCGCAT
AACACCCGCGGCTTCTCCGAGGAGGAGAGATTTGTTGCTCAGCTGCGCATGACCGAAGACGTGGGCGAGGCTGAT
ACAGACTCCGCCGAGCAAGGCGCCTTTGCCGGCTTGATGATGGCTTTGCGAGACGTCAAGATCTACGTCCTGATG
CTCACCTTTACCGCCTATGTCGTTGGCCTCTCCTTCAACGCCTTTTTCCCGACCCTTACCGGCACCCTGGGCTTC
GACTACGTTCCCACCTTGCTGCTGAGCTCTCCTCCTTGGGTTTTCTCCTGCATTATATCCGTCCTGGTCTCCTGG
CACTCGGACCGGACTCAGGAAAAGTTCTGGCATATCATCGGCCCCCTCATCCTGGGCATTGTGGGTTTTGTCATC
AGCATGTCGACACTCAACGTCGCCGCCCGCTACGTAGCCCTCTTTCTGCAGGCAGGCTCCTACGCCGGCTACATC
GTCTTCTACTCGTGGATCAGCTCCTCGTTCCCGCGCCCTCCGGCCAAGCGAGCCGTTGCCATTGCCATGATCAAC
GCCTTCAGCCAGCTGGGCAATGTGGCCGGGTCCTACGTTTGGGATCTCAAGGACAACGGCTATCGGAAGAGCTAC
GGCATTGTGCTCGCCATGTTCTGCGTGGCAGCGGTCGGAAGCTGGGTCTTCAAGACTATGCTGGGCAGGCTGAAC
GAGAAGCTGGAAGAAAACGAAAGGCGCGACGGAAGCGATCAGTCTGCTGAGGCCGAGTTCATCGAGAGCAGCGAC
GAGGCTCTGCGTATGAGGAAAGGATTCAGGTATTTGACGTAA
Transcript >Hirsu2|8883
ATGTCCAGCGACGACATCGCCCGGGCGCAGGGCGGCGCTTTCGACGGGCCTCCAGACGGCGAGAAGCACTTCGTC
CAGAAGCTCGAACACGCCGACCTCCCCTCGTCGCCAGCCCAGAATCACGAGATGGATCCGGCGCGGCGAGCCAGC
GTCGAGCGGCGCATGAAGCGCAAGCTCGATGCTCGCTGTGCCATCTTCGTCCTCATCTACATCATGAACTACCTC
GACCGCCAGACCATCTCGGCCGCGAGACTCAAGGGCCTGCAGGACGACCTGAAGCTCGACAACACCCAGTACGCG
ACGTGTCTCAGCATCCTCTACGTCGGCTACATCCTCATGCAGGTGCCGTCCAACATGGTCATCAACCGCATCCAG
CGACCGTCGCTCTACATCGCCGGCGCCATGACGCTCTGGGGCCTCATCAGCACGCTGAGCGGCATTGCACAGGAC
TTCGCCTCCATGGTCGTCATCCGCTTCTTCTTGGGCTTCGTCGAGGCAGCCTTCCTGCCCGGAGCCCTGCTGCTT
CTCTCCAAATGGTACACGCGCCGTGAGCTGACGACCCGAAACGCCATCCTCTTCTGCGGCAACCTCATCTCCAAC
GCCTTCTCCGCCCTTGTTGGCGCCGGGGTGCTCTCCAACATGCAGGGCGTTCTGGGCCATGCCGCGTGGAGATGG
CTTTTCTTCATCGAAGGCGCCGCAACCATGGCCATTGCGATTGGGGCCGCCTTTATTCTCCCGGACCTGCCGCAT
AACACCCGCGGCTTCTCCGAGGAGGAGAGATTTGTTGCTCAGCTGCGCATGACCGAAGACGTGGGCGAGGCTGAT
ACAGACTCCGCCGAGCAAGGCGCCTTTGCCGGCTTGATGATGGCTTTGCGAGACGTCAAGATCTACGTCCTGATG
CTCACCTTTACCGCCTATGTCGTTGGCCTCTCCTTCAACGCCTTTTTCCCGACCCTTACCGGCACCCTGGGCTTC
GACTACGTTCCCACCTTGCTGCTGAGCTCTCCTCCTTGGGTTTTCTCCTGCATTATATCCGTCCTGGTCTCCTGG
CACTCGGACCGGACTCAGGAAAAGTTCTGGCATATCATCGGCCCCCTCATCCTGGGCATTGTGGGTTTTGTCATC
AGCATGTCGACACTCAACGTCGCCGCCCGCTACGTAGCCCTCTTTCTGCAGGCAGGCTCCTACGCCGGCTACATC
GTCTTCTACTCGTGGATCAGCTCCTCGTTCCCGCGCCCTCCGGCCAAGCGAGCCGTTGCCATTGCCATGATCAAC
GCCTTCAGCCAGCTGGGCAATGTGGCCGGGTCCTACGTTTGGGATCTCAAGGACAACGGCTATCGGAAGAGCTAC
GGCATTGTGCTCGCCATGTTCTGCGTGGCAGCGGTCGGAAGCTGGGTCTTCAAGACTATGCTGGGCAGGCTGAAC
GAGAAGCTGGAAGAAAACGAAAGGCGCGACGGAAGCGATCAGTCTGCTGAGGCCGAGTTCATCGAGAGCAGCGAC
GAGGCTCTGCGTATGAGGAAAGGATTCAGGTATTTGACGTAA
Gene >Hirsu2|8883
ATGTCCAGCGACGACATCGCCCGGGCGCAGGGCGGCGCTTTCGACGGGCCTCCAGACGGCGAGAAGCACTTCGTC
CAGAAGCTCGAACACGCCGACCTCCCCTCGTCGCCAGCCCAGAATCACGAGATGGATCCGGCGCGGCGAGCCAGC
GTCGAGCGGCGCATGAAGCGCAAGCTCGATGCTCGCTGTGCCATCTTCGTCCTCATCTACATCATGAACTACCTC
GACCGCCAGACCATCTCGGCCGCGAGACTCAAGGGCCTGCAGGACGACCTGAAGCTCGACAACACCCAGTACGCG
ACGTGTCTCAGCATCCTCTACGTCGGCTACATCCTCATGCAGGTGCCGTCCAACATGGTCATCAACCGCATCCAG
CGACCGTCGCTCTACATCGCCGGCGCCATGACGCTCTGGGGCCTCATCAGCACGCTGAGCGGCATTGCACAGGAC
TTCGCCTCCATGGTCGTCATCCGCTTCTTCTTGGGCTTCGTCGAGGCAGCCTTCCTGCCCGGAGCCCTGCTGCTT
CTCTCCAAATGGTACACGCGCCGTGAGCTGACGACCCGAAACGCCATCCTCTTCTGCGGCAACCTCATCTCCAAC
GCCTTCTCCGCCCTTGTTGGCGCCGGGGTGCTCTCCAACATGCAGGGCGTTCTGGGCCATGCCGCGTGGAGATGG
CTTTTCTTCATCGAAGGCGCCGCAACCATGGCCATTGCGATTGGGGCCGCCTTTATTCTCCCGGACCTGCCGCAT
AACACCCGCGGCTTCTCCGAGGAGGAGAGATTTGTTGCTCAGCTGCGCATGACCGAAGACGTGGGCGAGGCTGAT
ACAGACTCCGCCGAGCAAGGCGCCTTTGCCGGCTTGATGATGGCTTTGCGAGACGTCAAGATCTACGTCCTGATG
CTCACCTTTACCGCCTATGTCGTTGGCCTCTCCTTCAACGCCTTTTTCGTAAGTCGTGCCGCCACGCCGTCCGGT
CTCGGCTGGGAACATCTCGAGACGTACGCTGACGCGATTCAAGCCGACCCTTACCGGCACCCTGGGCTTCGACTA
CGTTCCCACCTTGCTGCTGAGCTCTCCTCCTTGGGTTTTCTCCTGCATTATATCCGTCCTGGTCTCCTGGCACTC
GGACCGGACTCAGGAAAAGGTGAGTTTTGGTTTGACAAATCTTGACGCGCCAACAGTCTAACCACGATTCATTCA
GTTCTGGCATATCATCGGCCCCCTCATCCTGGGCATTGTGGGTTTTGTCATCAGCATGTCGACACTCAACGTCGC
CGCCCGCTACGTAGCCCTCTTTCTGCAGGCAGGCTCCTACGCCGGCTACATCGTCTTCTACTCGTGGATCAGCTC
CTCGTTCCCGCGCCCTCCGGCCAAGCGAGCCGTTGCCATTGCCATGATCAACGCCTTCAGCCAGCTGGGCAATGT
GGCCGGGTCCTACGTTTGGGATCTCAAGGACAACGGCTATCGGAAGAGCTACGGCATTGTGCTCGCCATGTTCTG
CGTGGCAGCGGTCGGAAGCTGGGTCTTCAAGACTATGCTGGGCAGGCTGAACGAGAAGCTGGAAGAAAACGAAAG
GCGCGACGGAAGCGATCAGTCTGCTGAGGCCGAGTTCATCGAGAGCAGCGACGAGGCTCTGCGTATGAGGAAAGG
ATTCAGGTATTTGACGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail