Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8881
Gene name
LocationContig_608:780..2341
Strand+
Gene length (bp)1561
Transcript length (bp)1485
Coding sequence length (bp)1485
Protein length (aa) 495

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 1.0E-54 78 472

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38680|MTR_NEUCR N amino acid transport system protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mtr PE=3 SV=2 24 494 0.0E+00

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

Domain # Start End Length
1 103 125 22
2 158 180 22
3 190 212 22
4 217 239 22
5 259 281 22
6 301 323 22
7 343 365 22
8 386 408 22
9 418 437 19
10 450 472 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8881
MESPVSSDGKTKMVGGSPDLAKTSSQPAHQRLHQQSTTPSEENVLSGSAIAGEVSEFEERRADVEKQKAAEGDAH
FHRLGWKRLTVILIVEAVALGSLSLPAAFATLGMVAGVFCTVGLGLIAIFTSDIVGQVKLKYPEVAHYADAGRLL
MGRFGYELVGAMFVLQLTFLVGSHTLTGTIAFLNMTDNGACSVIFGFVSAVILLALAVPPSFAEVAILGYIDFVS
IIAAIGLTIIATGIQASQREGGMASVDWSAWPKPGITFADAFIAIANIVFAYSFCMCQFTFMDEMHTPSDYIKSI
WSLGIIEIAIYTITGALVYAFVGVDVRSPALLSAGTLISKIAFGIALPVIFISGSINTTVIGRYLHGRMFRNSVT
RFINTPKGWATWLALITVITIIAFVIAEVIPFFSDLLSISSSLFVSGFTFYLPAMMWFQLLCKGKWYARENIVKS
LMSAFCFVIGIVVLVCGTYASIDDIAHQFNNGSVRGVFTCKPIA*
Coding >Hirsu2|8881
ATGGAGTCACCCGTGTCTTCAGATGGCAAGACCAAGATGGTCGGCGGCTCGCCGGACCTGGCCAAGACGTCGTCG
CAGCCCGCCCACCAGCGGCTTCACCAGCAGTCGACGACGCCGTCGGAGGAGAACGTGCTGAGCGGCAGCGCCATC
GCCGGCGAGGTCAGCGAGTTCGAGGAGCGCCGGGCCGACGTCGAGAAGCAGAAGGCGGCCGAGGGCGACGCCCAC
TTCCACCGGCTGGGTTGGAAGCGCCTGACCGTTATCCTCATCGTCGAGGCCGTCGCCCTCGGCAGCCTGAGTCTG
CCGGCCGCCTTCGCCACCCTAGGCATGGTCGCCGGCGTCTTCTGCACCGTCGGCCTCGGCCTCATCGCCATCTTC
ACCAGCGATATCGTCGGCCAGGTTAAGCTAAAGTATCCCGAGGTCGCCCACTATGCCGACGCCGGCCGCCTGCTC
ATGGGCCGCTTCGGGTACGAGCTCGTCGGCGCTATGTTCGTTTTGCAGCTCACCTTCCTCGTCGGCTCGCATACC
CTAACAGGAACGATTGCCTTCCTTAATATGACCGACAACGGCGCCTGCTCCGTCATCTTCGGCTTCGTCTCCGCC
GTCATCCTCCTCGCTCTAGCCGTGCCCCCGTCCTTCGCCGAGGTCGCTATCCTTGGCTATATCGACTTCGTTTCT
ATTATCGCCGCCATCGGTCTCACGATTATCGCCACCGGCATCCAGGCGTCCCAGAGGGAGGGCGGCATGGCTTCG
GTAGACTGGTCCGCCTGGCCCAAGCCCGGCATCACCTTCGCCGACGCCTTCATCGCCATCGCCAACATTGTGTTC
GCCTATAGCTTCTGCATGTGCCAGTTCACCTTTATGGACGAGATGCACACCCCCTCGGACTATATTAAGTCTATC
TGGTCGCTCGGCATCATCGAAATCGCTATCTATACTATCACCGGCGCCCTAGTATATGCCTTTGTTGGCGTCGAT
GTCCGGTCGCCTGCCCTGTTGTCTGCGGGCACCCTCATCTCCAAAATCGCCTTCGGCATCGCCCTGCCCGTCATC
TTCATCTCCGGCTCCATCAACACCACCGTCATAGGCCGCTACCTGCACGGTCGCATGTTCCGCAACTCCGTCACC
CGCTTCATCAACACGCCAAAGGGCTGGGCAACGTGGCTTGCTCTCATCACCGTCATCACCATCATCGCCTTCGTT
ATCGCCGAAGTCATCCCCTTCTTCTCCGACCTCCTCTCCATCTCCTCTTCCCTCTTCGTCTCTGGCTTCACTTTC
TATCTCCCGGCTATGATGTGGTTCCAGCTGTTATGCAAGGGCAAATGGTACGCGAGAGAAAACATCGTCAAGAGC
TTGATGAGCGCCTTCTGCTTCGTCATTGGAATTGTTGTGCTGGTATGCGGTACATATGCCAGCATTGATGATATT
GCCCACCAATTCAACAATGGGTCCGTTCGCGGCGTCTTCACCTGCAAACCCATCGCATAA
Transcript >Hirsu2|8881
ATGGAGTCACCCGTGTCTTCAGATGGCAAGACCAAGATGGTCGGCGGCTCGCCGGACCTGGCCAAGACGTCGTCG
CAGCCCGCCCACCAGCGGCTTCACCAGCAGTCGACGACGCCGTCGGAGGAGAACGTGCTGAGCGGCAGCGCCATC
GCCGGCGAGGTCAGCGAGTTCGAGGAGCGCCGGGCCGACGTCGAGAAGCAGAAGGCGGCCGAGGGCGACGCCCAC
TTCCACCGGCTGGGTTGGAAGCGCCTGACCGTTATCCTCATCGTCGAGGCCGTCGCCCTCGGCAGCCTGAGTCTG
CCGGCCGCCTTCGCCACCCTAGGCATGGTCGCCGGCGTCTTCTGCACCGTCGGCCTCGGCCTCATCGCCATCTTC
ACCAGCGATATCGTCGGCCAGGTTAAGCTAAAGTATCCCGAGGTCGCCCACTATGCCGACGCCGGCCGCCTGCTC
ATGGGCCGCTTCGGGTACGAGCTCGTCGGCGCTATGTTCGTTTTGCAGCTCACCTTCCTCGTCGGCTCGCATACC
CTAACAGGAACGATTGCCTTCCTTAATATGACCGACAACGGCGCCTGCTCCGTCATCTTCGGCTTCGTCTCCGCC
GTCATCCTCCTCGCTCTAGCCGTGCCCCCGTCCTTCGCCGAGGTCGCTATCCTTGGCTATATCGACTTCGTTTCT
ATTATCGCCGCCATCGGTCTCACGATTATCGCCACCGGCATCCAGGCGTCCCAGAGGGAGGGCGGCATGGCTTCG
GTAGACTGGTCCGCCTGGCCCAAGCCCGGCATCACCTTCGCCGACGCCTTCATCGCCATCGCCAACATTGTGTTC
GCCTATAGCTTCTGCATGTGCCAGTTCACCTTTATGGACGAGATGCACACCCCCTCGGACTATATTAAGTCTATC
TGGTCGCTCGGCATCATCGAAATCGCTATCTATACTATCACCGGCGCCCTAGTATATGCCTTTGTTGGCGTCGAT
GTCCGGTCGCCTGCCCTGTTGTCTGCGGGCACCCTCATCTCCAAAATCGCCTTCGGCATCGCCCTGCCCGTCATC
TTCATCTCCGGCTCCATCAACACCACCGTCATAGGCCGCTACCTGCACGGTCGCATGTTCCGCAACTCCGTCACC
CGCTTCATCAACACGCCAAAGGGCTGGGCAACGTGGCTTGCTCTCATCACCGTCATCACCATCATCGCCTTCGTT
ATCGCCGAAGTCATCCCCTTCTTCTCCGACCTCCTCTCCATCTCCTCTTCCCTCTTCGTCTCTGGCTTCACTTTC
TATCTCCCGGCTATGATGTGGTTCCAGCTGTTATGCAAGGGCAAATGGTACGCGAGAGAAAACATCGTCAAGAGC
TTGATGAGCGCCTTCTGCTTCGTCATTGGAATTGTTGTGCTGGTATGCGGTACATATGCCAGCATTGATGATATT
GCCCACCAATTCAACAATGGGTCCGTTCGCGGCGTCTTCACCTGCAAACCCATCGCATAA
Gene >Hirsu2|8881
ATGGAGTCACCCGTGTCTTCAGATGGCAAGACCAAGATGGTCGGCGGCTCGCCGGACCTGGCCAAGACGTCGTCG
CAGCCCGCCCACCAGCGGCTTCACCAGCAGTCGACGACGCCGTCGGAGGAGAACGTGCTGAGCGGCAGCGCCATC
GCCGGCGAGGTCAGCGAGTTCGAGGAGCGCCGGGCCGACGTCGAGAAGCAGAAGGCGGCCGAGGGCGACGCCCAC
TTCCACCGGCTGGGTTGGAAGCGCCTGACCGTTATCCTCATCGTCGAGGCCGTCGCCCTCGGCAGCCTGAGTCTG
CCGGCCGCCTTCGCCACCCTAGGCATGGTCGCCGGCGTCTTCTGCACCGTCGGCCTCGGCCTCATCGCCATCTTC
ACCAGCGATATCGTCGGCCAGGTTAAGCTAAAGTATCCCGAGGTCGCCCACTATGCCGACGCCGGCCGCCTGCTC
ATGGGCCGCTTCGGGTACGAGCTCGTCGGCGCTATGTTCGTTTTGCAGCTCACCTTCCTCGTCGGCTCGCATACC
CTAACAGGAACGATTGCCTTCCTTAATATGACCGACAACGGCGCCTGCTCCGTCATCTTCGGCTTCGTCTCCGCC
GTCATCCTCCTCGCTCTAGCCGTGCCCCCGTCCTTCGCCGAGGTCGCTATCCTTGGCTATATCGACTTCGTTTCT
ATTATCGCCGCCATCGGTCTCACGATTATCGCCACCGGCATCCAGGCGTCCCAGAGGGAGGGCGGCATGGCTTCG
GTAGACTGGTCCGCCTGGCCCAAGCCCGGCATCACCTTCGCCGACGCCTTCATCGCCATCGCCAACATTGTGTTC
GCCTATAGCTTCTGCATGTGCCAGTTCACCTTTATGGACGAGATGCACACCCCCTCGGACTATATTAAGTCTATC
TGGTCGCTCGGCATCATCGAAATCGCTATCTATACTATCACCGGCGCCCTAGTATATGCCTTTGTTGGCGTCGAT
GTCCGGTCGCCTGCCCTGTTGTCTGCGGGCACCCTCATCTCCAAAATCGCCTTCGGCATCGCCCTGCCCGTCATC
TTCATCTCCGGCTCCATCAACACCACCGTCATAGGCCGCTACCTGCACGGTCGCATGTTCCGCAACTCCGTCACC
CGCTTCATCAACACGCCAAAGGGCTGGGCAACGTGGCTTGCTCTCATCACCGTCATCACCATCATCGCCTTCGTT
ATCGCCGAAGTCATCCCCTTCTTCTCCGACCTCCTCTCCATCTCCTCTTCCCTCTTCGTCTCTGGCTTCACTTTC
TATCTCCCGGCTATGATGTGGTTCCAGCTGTTATGCAAGGGCAAATGGTACGCGAGAGAAAACATCGTCAAGAGC
TTGATGAGCGCCTTCTGCTTCGTCATTGGAATTGTTGTGCTGGTATGCGGTACATATGCCAGCATTGATGATATT
GTACGCCCCCCCCCCTCCCGCTGACGCCGTGTCCTGCCGCTCTCGCAACTCCCATGCTAACGTGATGATTTTCCA
GGCCCACCAATTCAACAATGGGTCCGTTCGCGGCGTCTTCACCTGCAAACCCATCGCATAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail