Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8877
Gene name
LocationContig_607:6559..8275
Strand-
Gene length (bp)1716
Transcript length (bp)1716
Coding sequence length (bp)1716
Protein length (aa) 572

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.6E-50 111 508
PF00083 Sugar_tr Sugar (and other) transporter 9.1E-08 112 288

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 54 556 6.0E-66
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 93 556 2.0E-65
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 94 554 1.0E-56
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 81 530 2.0E-52
sp|Q5A6P6|QDR1_CANAL MFS antiporter QDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR PE=2 SV=1 94 529 6.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 54 556 6.0E-66
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 93 556 2.0E-65
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 94 554 1.0E-56
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 81 530 2.0E-52
sp|Q5A6P6|QDR1_CANAL MFS antiporter QDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR PE=2 SV=1 94 529 6.0E-47
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 60 531 3.0E-37
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 58 552 3.0E-26
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 49 287 4.0E-25
sp|O34307|YVMA_BACSU Uncharacterized MFS-type transporter YvmA OS=Bacillus subtilis (strain 168) GN=yvmA PE=3 SV=1 97 556 6.0E-22
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 14 293 1.0E-21
sp|P32482|CMLA_PSEAI Chloramphenicol resistance protein OS=Pseudomonas aeruginosa GN=cmlA PE=3 SV=2 115 267 1.0E-21
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 98 535 3.0E-20
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 103 554 3.0E-18
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 103 554 2.0E-17
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 103 390 4.0E-16
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 99 553 7.0E-16
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 121 554 8.0E-16
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 98 552 2.0E-15
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 101 570 5.0E-15
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 327 551 7.0E-15
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 76 532 1.0E-13
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 119 502 1.0E-12
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 119 502 1.0E-12
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 76 545 9.0E-12
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 121 551 1.0E-11
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 103 545 2.0E-11
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 119 536 3.0E-11
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 99 285 4.0E-11
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 128 535 5.0E-11
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 119 283 9.0E-11
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 128 535 1.0E-10
sp|P37597|YDHC_ECOLI Inner membrane transport protein YdhC OS=Escherichia coli (strain K12) GN=ydhC PE=1 SV=3 114 262 8.0E-10
sp|P96709|YDGK_BACSU Uncharacterized MFS-type transporter YdgK OS=Bacillus subtilis (strain 168) GN=ydgK PE=3 SV=1 114 270 1.0E-09
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 114 263 2.0E-09
sp|P94574|YWOD_BACSU Uncharacterized MFS-type transporter YwoD OS=Bacillus subtilis (strain 168) GN=ywoD PE=3 SV=1 99 293 2.0E-09
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 100 290 4.0E-09
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 112 262 5.0E-09
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 123 508 5.0E-09
sp|Q8C0T7|MFSD9_MOUSE Major facilitator superfamily domain-containing protein 9 OS=Mus musculus GN=Mfsd9 PE=2 SV=1 65 302 1.0E-08
sp|O34502|YVKA_BACSU Uncharacterized MFS-type transporter YvkA OS=Bacillus subtilis (strain 168) GN=yvkA PE=3 SV=1 112 270 4.0E-08
sp|O35018|LMRB_BACSU Lincomycin resistance protein LmrB OS=Bacillus subtilis (strain 168) GN=lmrB PE=3 SV=1 127 285 7.0E-08
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 52 408 8.0E-08
sp|Q87FV4|MDTL_VIBPA Multidrug resistance protein MdtL OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=mdtL PE=3 SV=1 118 304 8.0E-08
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 103 390 1.0E-07
sp|Q8Y9K8|LMRB_LISMO Lincomycin resistance protein LmrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmrB PE=3 SV=1 127 274 3.0E-07
sp|Q92EE1|LMRB_LISIN Lincomycin resistance protein LmrB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lmrB PE=3 SV=1 127 274 3.0E-07
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 328 553 4.0E-07
sp|P0A4K6|TCR_STREE Tetracycline resistance protein OS=Streptococcus pneumoniae GN=tet PE=3 SV=1 104 285 4.0E-07
sp|P0A4K8|TCR_BACIU Tetracycline resistance protein OS=Bacillus subtilis GN=tet PE=3 SV=1 104 285 4.0E-07
sp|P0A4K7|TCR_BACCE Tetracycline resistance protein OS=Bacillus cereus GN=tet PE=3 SV=1 104 285 4.0E-07
sp|Q8FBV0|MDTL_ECOL6 Multidrug resistance protein MdtL OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtL PE=3 SV=1 118 267 4.0E-07
sp|B7N2F5|MDTL_ECO81 Multidrug resistance protein MdtL OS=Escherichia coli O81 (strain ED1a) GN=mdtL PE=3 SV=1 118 267 4.0E-07
sp|P07561|TCR_GEOSE Tetracycline resistance protein OS=Geobacillus stearothermophilus GN=tet PE=3 SV=1 104 285 4.0E-07
sp|P36890|TCR_STAHY Tetracycline resistance protein OS=Staphylococcus hyicus GN=tet PE=3 SV=1 104 258 4.0E-07
sp|P23054|TCRB_BACSU Tetracycline resistance protein OS=Bacillus subtilis (strain 168) GN=tetB PE=3 SV=1 96 285 4.0E-07
sp|P39386|MDTM_ECOLI Multidrug resistance protein MdtM OS=Escherichia coli (strain K12) GN=mdtM PE=1 SV=1 128 294 4.0E-07
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 103 532 5.0E-07
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 99 263 5.0E-07
sp|P81721|VACHT_TORCA Vesicular acetylcholine transporter OS=Torpedo californica PE=2 SV=2 142 257 7.0E-07
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 35 558 7.0E-07
sp|Q91498|VACHT_TORMA Vesicular acetylcholine transporter OS=Torpedo marmorata PE=2 SV=2 142 257 8.0E-07
sp|B7UMH7|MDTL_ECO27 Multidrug resistance protein MdtL OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtL PE=3 SV=1 118 263 8.0E-07
sp|Q0TAZ8|MDTL_ECOL5 Multidrug resistance protein MdtL OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtL PE=3 SV=1 118 263 8.0E-07
sp|Q1R4M4|MDTL_ECOUT Multidrug resistance protein MdtL OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtL PE=3 SV=1 118 263 8.0E-07
sp|A1AHP3|MDTL_ECOK1 Multidrug resistance protein MdtL OS=Escherichia coli O1:K1 / APEC GN=mdtL PE=3 SV=1 118 263 8.0E-07
sp|B7MGD1|MDTL_ECO45 Multidrug resistance protein MdtL OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtL PE=3 SV=1 118 263 8.0E-07
sp|Q91514|VACHT_TORTO Vesicular acetylcholine transporter OS=Torpedo torpedo PE=2 SV=1 142 257 8.0E-07
sp|Q8ZKY1|MDTL_SALTY Multidrug resistance protein MdtL OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtL PE=3 SV=1 118 263 1.0E-06
sp|Q0P5M9|MFS10_BOVIN Major facilitator superfamily domain-containing protein 10 OS=Bos taurus GN=MFSD10 PE=2 SV=1 127 454 1.0E-06
sp|B4TN12|MDTL_SALSV Multidrug resistance protein MdtL OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtL PE=3 SV=1 118 263 1.0E-06
sp|A9MX86|MDTL_SALPB Multidrug resistance protein MdtL OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtL PE=3 SV=1 118 263 1.0E-06
sp|B4SYB3|MDTL_SALNS Multidrug resistance protein MdtL OS=Salmonella newport (strain SL254) GN=mdtL PE=3 SV=1 118 263 1.0E-06
sp|B4TAV4|MDTL_SALHS Multidrug resistance protein MdtL OS=Salmonella heidelberg (strain SL476) GN=mdtL PE=3 SV=1 118 263 1.0E-06
sp|Q9MZD1|S17A5_SHEEP Sialin OS=Ovis aries GN=SLC17A5 PE=2 SV=1 187 454 1.0E-06
sp|B5EYX7|MDTL_SALA4 Multidrug resistance protein MdtL OS=Salmonella agona (strain SL483) GN=mdtL PE=3 SV=1 118 263 1.0E-06
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 106 264 1.0E-06
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 106 264 1.0E-06
sp|Q328Z8|MDTL_SHIDS Multidrug resistance protein MdtL OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mdtL PE=3 SV=1 118 267 1.0E-06
sp|P31442|EMRD_ECOLI Multidrug resistance protein D OS=Escherichia coli (strain K12) GN=emrD PE=1 SV=2 119 268 1.0E-06
sp|C0Q2L5|MDTL_SALPC Multidrug resistance protein MdtL OS=Salmonella paratyphi C (strain RKS4594) GN=mdtL PE=3 SV=1 118 263 2.0E-06
sp|Q57HZ5|MDTL_SALCH Multidrug resistance protein MdtL OS=Salmonella choleraesuis (strain SC-B67) GN=mdtL PE=3 SV=1 118 263 2.0E-06
sp|Q8Z2N9|MDTL_SALTI Multidrug resistance protein MdtL OS=Salmonella typhi GN=mdtL PE=3 SV=1 118 263 2.0E-06
sp|B5BIM0|MDTL_SALPK Multidrug resistance protein MdtL OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtL PE=3 SV=1 118 263 2.0E-06
sp|Q5PKV6|MDTL_SALPA Multidrug resistance protein MdtL OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtL PE=3 SV=1 118 263 2.0E-06
sp|Q8XB84|MDTM_ECO57 Multidrug resistance protein MdtM OS=Escherichia coli O157:H7 GN=mdtM PE=3 SV=1 128 294 2.0E-06
sp|Q0SYP9|MDTL_SHIF8 Multidrug resistance protein MdtL OS=Shigella flexneri serotype 5b (strain 8401) GN=mdtL PE=3 SV=1 118 263 2.0E-06
sp|B7M562|MDTL_ECO8A Multidrug resistance protein MdtL OS=Escherichia coli O8 (strain IAI1) GN=mdtL PE=3 SV=1 118 267 2.0E-06
sp|A7ZTR5|MDTL_ECO24 Multidrug resistance protein MdtL OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtL PE=3 SV=1 118 267 2.0E-06
sp|B1LL36|MDTL_ECOSM Multidrug resistance protein MdtL OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdtL PE=3 SV=1 118 263 2.0E-06
sp|B7NF27|MDTL_ECOLU Multidrug resistance protein MdtL OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtL PE=3 SV=1 118 263 2.0E-06
sp|B7NR12|MDTL_ECO7I Multidrug resistance protein MdtL OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mdtL PE=3 SV=1 118 263 2.0E-06
sp|B7LK52|MDTL_ESCF3 Multidrug resistance protein MdtL OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtL PE=3 SV=1 118 263 2.0E-06
sp|Q3YWK3|MDTL_SHISS Multidrug resistance protein MdtL OS=Shigella sonnei (strain Ss046) GN=mdtL PE=3 SV=1 118 263 3.0E-06
sp|Q31UW4|MDTL_SHIBS Multidrug resistance protein MdtL OS=Shigella boydii serotype 4 (strain Sb227) GN=mdtL PE=3 SV=1 118 263 3.0E-06
sp|B2TUR5|MDTL_SHIB3 Multidrug resistance protein MdtL OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtL PE=3 SV=1 118 263 3.0E-06
sp|B1IX28|MDTL_ECOLC Multidrug resistance protein MdtL OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtL PE=3 SV=1 118 263 3.0E-06
sp|A8A6H2|MDTL_ECOHS Multidrug resistance protein MdtL OS=Escherichia coli O9:H4 (strain HS) GN=mdtL PE=3 SV=1 118 263 3.0E-06
sp|B6I3U3|MDTL_ECOSE Multidrug resistance protein MdtL OS=Escherichia coli (strain SE11) GN=mdtL PE=3 SV=1 118 263 3.0E-06
sp|P31462|MDTL_ECOLI Multidrug resistance protein MdtL OS=Escherichia coli (strain K12) GN=mdtL PE=1 SV=2 118 263 3.0E-06
sp|B1X9T9|MDTL_ECODH Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / DH10B) GN=mdtL PE=3 SV=1 118 263 3.0E-06
sp|C4ZYY8|MDTL_ECOBW Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtL PE=3 SV=1 118 263 3.0E-06
sp|B7L855|MDTL_ECO55 Multidrug resistance protein MdtL OS=Escherichia coli (strain 55989 / EAEC) GN=mdtL PE=3 SV=1 118 263 3.0E-06
sp|Q83PL6|MDTL_SHIFL Multidrug resistance protein MdtL OS=Shigella flexneri GN=mdtL PE=3 SV=1 118 263 3.0E-06
sp|P0A4K5|PMRA_STRR6 Multi-drug resistance efflux pump PmrA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pmrA PE=3 SV=1 159 350 3.0E-06
sp|P0A4K4|PMRA_STRPN Multi-drug resistance efflux pump PmrA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pmrA PE=3 SV=1 159 350 3.0E-06
sp|B5QUQ6|MDTL_SALEP Multidrug resistance protein MdtL OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtL PE=3 SV=1 118 263 3.0E-06
sp|B5FN15|MDTL_SALDC Multidrug resistance protein MdtL OS=Salmonella dublin (strain CT_02021853) GN=mdtL PE=3 SV=1 118 263 3.0E-06
sp|P94422|YCNB_BACSU Uncharacterized MFS-type transporter YcnB OS=Bacillus subtilis (strain 168) GN=ycnB PE=3 SV=1 147 274 3.0E-06
sp|Q08C75|VACHA_DANRE Probable vesicular acetylcholine transporter-A OS=Danio rerio GN=slc18a3a PE=2 SV=1 133 265 3.0E-06
sp|P59845|VACHB_DANRE Probable vesicular acetylcholine transporter-B OS=Danio rerio GN=slc18a3b PE=2 SV=1 129 257 3.0E-06
sp|Q27963|VMAT2_BOVIN Synaptic vesicular amine transporter OS=Bos taurus GN=SLC18A2 PE=1 SV=1 171 262 3.0E-06
sp|B5YXB4|MDTL_ECO5E Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtL PE=3 SV=1 118 267 4.0E-06
sp|Q8XB24|MDTL_ECO57 Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 GN=mdtL PE=3 SV=1 118 267 4.0E-06
sp|A9N7L0|MDTD_SALPB Putative multidrug resistance protein MdtD OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtD PE=3 SV=1 105 262 4.0E-06
sp|B4T9U3|MDTD_SALHS Putative multidrug resistance protein MdtD OS=Salmonella heidelberg (strain SL476) GN=mdtD PE=3 SV=1 105 262 4.0E-06
sp|B5XZP2|MDTL_KLEP3 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae (strain 342) GN=mdtL PE=3 SV=1 118 263 4.0E-06
sp|Q4UMJ9|BCRH_RICFE Uncharacterized transporter RF_0358 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0358 PE=3 SV=1 115 283 5.0E-06
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 88 262 5.0E-06
sp|B5FMU8|MDTD_SALDC Putative multidrug resistance protein MdtD OS=Salmonella dublin (strain CT_02021853) GN=mdtD PE=3 SV=1 105 262 5.0E-06
sp|P62967|TCR_STAES Tetracycline resistance protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=tet PE=3 SV=1 90 258 6.0E-06
sp|P02983|TCR_STAAU Tetracycline resistance protein OS=Staphylococcus aureus GN=tet PE=3 SV=3 90 258 6.0E-06
sp|A9MJT5|MDTL_SALAR Multidrug resistance protein MdtL OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mdtL PE=3 SV=1 118 263 6.0E-06
sp|B4SXW2|MDTD_SALNS Putative multidrug resistance protein MdtD OS=Salmonella newport (strain SL254) GN=mdtD PE=3 SV=1 105 262 6.0E-06
sp|B5R0C2|MDTD_SALEP Putative multidrug resistance protein MdtD OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtD PE=3 SV=1 105 262 6.0E-06
sp|B5EXV9|MDTD_SALA4 Putative multidrug resistance protein MdtD OS=Salmonella agona (strain SL483) GN=mdtD PE=3 SV=1 105 262 6.0E-06
sp|B5BF67|MDTD_SALPK Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtD PE=3 SV=1 105 262 6.0E-06
sp|Q5PDW9|MDTD_SALPA Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtD PE=3 SV=1 105 262 6.0E-06
sp|Q05940|VMAT2_HUMAN Synaptic vesicular amine transporter OS=Homo sapiens GN=SLC18A2 PE=1 SV=2 177 257 6.0E-06
sp|Q8ZNQ0|MDTD_SALTY Putative multidrug resistance protein MdtD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtD PE=3 SV=1 105 262 7.0E-06
sp|B4TNI8|MDTD_SALSV Putative multidrug resistance protein MdtD OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtD PE=3 SV=1 105 262 7.0E-06
sp|P13924|TCR_STRAG Tetracycline resistance protein OS=Streptococcus agalactiae GN=tet PE=3 SV=1 104 285 7.0E-06
sp|Q8Z5F5|MDTD_SALTI Putative multidrug resistance protein MdtD OS=Salmonella typhi GN=mdtD PE=3 SV=1 96 262 8.0E-06
sp|A0L190|MDTL_SHESA Multidrug resistance protein MdtL OS=Shewanella sp. (strain ANA-3) GN=mdtL PE=3 SV=1 118 267 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 104 126 22
2 139 161 22
3 171 189 18
4 196 218 22
5 228 250 22
6 255 277 22
7 341 363 22
8 376 398 22
9 431 450 19
10 462 484 22
11 520 542 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8877
MDHAARCPPSPPRHCPSPEPEGGHHGAGSASASATATTITTESLGHVPSRFTASESDSLERKPGAIVVPASAPAD
RDAAYHVEPAVGDAARFPPYSAFSRSTKIWVTTMVTISSVISPMTANVYFPALNAVADSLDVSISLINLTLTTYM
IFQGLSPTIFGDFGDMAGRRPAFIVAFLIYLVANIGLALQRNYAALMVLRCLQSAGSSGTLALGYAVIADIASRE
ERGVYMGLVSAGVNFGPAIGPVLGGVLSQYLGWPSIFWFCAIFVFLWLIPWILSVPETCRTVVGNGSIPPPKWNM
TLIDFIRCRGVNQRPESAPRVKLRVPNPLRTLYIVLRKEEGLILFISAIIYLNFILVSATLSTMFKSIYSYNELE
VGLCYLPYGIGCCLASLGQGYIVDWNYRRMASKLGVSLYRKSDEDLISFPVESARIQLVYPALLVGAAALIGWGW
TLQVETNVAAPLVLLFIIGMLVPTSFSVLNTLIVDLNPHAPATAAAANNLVRCSFGAAATAVIDYMLEAMGRGWC
FTFLALLMISCFAGLRVLEKCGPRWRAERARLAGGGDDSRTTSREK*
Coding >Hirsu2|8877
ATGGACCATGCCGCCCGCTGCCCGCCGTCGCCGCCTCGCCATTGCCCGTCCCCGGAGCCGGAGGGGGGGCATCAC
GGCGCCGGCTCGGCCTCGGCATCCGCCACCGCCACCACCATCACCACCGAGTCGCTCGGCCATGTCCCCAGCCGC
TTCACCGCCTCCGAGTCGGACAGCCTCGAGCGCAAGCCAGGCGCCATCGTCGTCCCCGCGTCCGCCCCCGCCGAC
CGGGACGCCGCCTACCACGTCGAGCCCGCCGTCGGAGACGCCGCCCGTTTCCCGCCGTACAGCGCCTTCTCGCGA
TCGACCAAGATTTGGGTCACGACCATGGTCACCATCTCGAGCGTCATCTCGCCCATGACGGCCAACGTCTACTTC
CCCGCCCTCAACGCCGTCGCCGACAGCCTCGACGTCTCCATCTCCCTCATCAACCTCACCCTGACCACCTACATG
ATCTTCCAGGGCCTGTCCCCCACCATCTTTGGCGACTTCGGCGACATGGCCGGCCGCCGGCCCGCCTTCATCGTC
GCCTTTCTCATCTATCTCGTCGCCAACATCGGCCTGGCCTTGCAGCGAAACTACGCCGCCCTCATGGTGCTCCGC
TGTCTGCAGTCGGCCGGCAGCAGCGGCACCCTCGCCCTCGGCTACGCCGTCATCGCCGACATCGCGTCCAGGGAG
GAGCGCGGCGTCTACATGGGCCTCGTCAGCGCCGGTGTCAACTTCGGGCCCGCCATCGGCCCCGTCCTGGGCGGC
GTCCTGAGCCAGTACCTCGGCTGGCCCTCCATCTTCTGGTTCTGCGCCATCTTCGTCTTCCTCTGGCTCATCCCC
TGGATACTCTCCGTCCCCGAGACCTGCCGTACCGTCGTCGGCAACGGCTCGATACCCCCGCCCAAGTGGAACATG
ACGCTCATCGACTTCATCCGATGCCGCGGCGTCAACCAGCGACCCGAGTCGGCCCCCCGCGTCAAGCTGCGAGTC
CCCAACCCGCTGCGCACGCTGTACATAGTCTTGCGCAAGGAGGAGGGCCTCATCTTGTTCATCTCGGCCATCATC
TACCTCAACTTCATCTTGGTCTCGGCCACGCTGTCCACCATGTTCAAGAGCATATACTCGTACAACGAGCTCGAG
GTTGGACTCTGCTACCTGCCGTATGGAATCGGCTGCTGTCTCGCCAGCCTCGGCCAGGGATACATCGTCGACTGG
AACTACCGCAGGATGGCCAGCAAGCTCGGCGTGTCCCTGTATCGCAAGTCGGACGAGGACCTCATCAGCTTCCCG
GTCGAGAGCGCCCGCATCCAGCTCGTCTACCCCGCCCTGCTGGTCGGTGCCGCCGCGCTCATCGGCTGGGGGTGG
ACCTTGCAGGTCGAGACCAACGTGGCGGCGCCGCTGGTGCTCCTCTTCATCATTGGCATGCTCGTCCCGACGTCG
TTCAGCGTCCTCAACACGCTCATTGTCGATCTCAACCCGCACGCTCCCGCCACGGCGGCGGCGGCCAACAACTTG
GTGCGCTGCTCCTTCGGCGCGGCGGCGACGGCCGTCATCGATTACATGCTCGAGGCCATGGGCCGCGGCTGGTGC
TTCACCTTCCTCGCCCTCCTCATGATATCCTGCTTCGCCGGGCTGAGAGTGTTGGAGAAGTGCGGCCCCCGCTGG
AGGGCCGAGAGGGCCAGGCTGGCTGGCGGCGGCGACGACAGCCGGACCACGTCGCGAGAAAAGTAA
Transcript >Hirsu2|8877
ATGGACCATGCCGCCCGCTGCCCGCCGTCGCCGCCTCGCCATTGCCCGTCCCCGGAGCCGGAGGGGGGGCATCAC
GGCGCCGGCTCGGCCTCGGCATCCGCCACCGCCACCACCATCACCACCGAGTCGCTCGGCCATGTCCCCAGCCGC
TTCACCGCCTCCGAGTCGGACAGCCTCGAGCGCAAGCCAGGCGCCATCGTCGTCCCCGCGTCCGCCCCCGCCGAC
CGGGACGCCGCCTACCACGTCGAGCCCGCCGTCGGAGACGCCGCCCGTTTCCCGCCGTACAGCGCCTTCTCGCGA
TCGACCAAGATTTGGGTCACGACCATGGTCACCATCTCGAGCGTCATCTCGCCCATGACGGCCAACGTCTACTTC
CCCGCCCTCAACGCCGTCGCCGACAGCCTCGACGTCTCCATCTCCCTCATCAACCTCACCCTGACCACCTACATG
ATCTTCCAGGGCCTGTCCCCCACCATCTTTGGCGACTTCGGCGACATGGCCGGCCGCCGGCCCGCCTTCATCGTC
GCCTTTCTCATCTATCTCGTCGCCAACATCGGCCTGGCCTTGCAGCGAAACTACGCCGCCCTCATGGTGCTCCGC
TGTCTGCAGTCGGCCGGCAGCAGCGGCACCCTCGCCCTCGGCTACGCCGTCATCGCCGACATCGCGTCCAGGGAG
GAGCGCGGCGTCTACATGGGCCTCGTCAGCGCCGGTGTCAACTTCGGGCCCGCCATCGGCCCCGTCCTGGGCGGC
GTCCTGAGCCAGTACCTCGGCTGGCCCTCCATCTTCTGGTTCTGCGCCATCTTCGTCTTCCTCTGGCTCATCCCC
TGGATACTCTCCGTCCCCGAGACCTGCCGTACCGTCGTCGGCAACGGCTCGATACCCCCGCCCAAGTGGAACATG
ACGCTCATCGACTTCATCCGATGCCGCGGCGTCAACCAGCGACCCGAGTCGGCCCCCCGCGTCAAGCTGCGAGTC
CCCAACCCGCTGCGCACGCTGTACATAGTCTTGCGCAAGGAGGAGGGCCTCATCTTGTTCATCTCGGCCATCATC
TACCTCAACTTCATCTTGGTCTCGGCCACGCTGTCCACCATGTTCAAGAGCATATACTCGTACAACGAGCTCGAG
GTTGGACTCTGCTACCTGCCGTATGGAATCGGCTGCTGTCTCGCCAGCCTCGGCCAGGGATACATCGTCGACTGG
AACTACCGCAGGATGGCCAGCAAGCTCGGCGTGTCCCTGTATCGCAAGTCGGACGAGGACCTCATCAGCTTCCCG
GTCGAGAGCGCCCGCATCCAGCTCGTCTACCCCGCCCTGCTGGTCGGTGCCGCCGCGCTCATCGGCTGGGGGTGG
ACCTTGCAGGTCGAGACCAACGTGGCGGCGCCGCTGGTGCTCCTCTTCATCATTGGCATGCTCGTCCCGACGTCG
TTCAGCGTCCTCAACACGCTCATTGTCGATCTCAACCCGCACGCTCCCGCCACGGCGGCGGCGGCCAACAACTTG
GTGCGCTGCTCCTTCGGCGCGGCGGCGACGGCCGTCATCGATTACATGCTCGAGGCCATGGGCCGCGGCTGGTGC
TTCACCTTCCTCGCCCTCCTCATGATATCCTGCTTCGCCGGGCTGAGAGTGTTGGAGAAGTGCGGCCCCCGCTGG
AGGGCCGAGAGGGCCAGGCTGGCTGGCGGCGGCGACGACAGCCGGACCACGTCGCGAGAAAAGTAA
Gene >Hirsu2|8877
ATGGACCATGCCGCCCGCTGCCCGCCGTCGCCGCCTCGCCATTGCCCGTCCCCGGAGCCGGAGGGGGGGCATCAC
GGCGCCGGCTCGGCCTCGGCATCCGCCACCGCCACCACCATCACCACCGAGTCGCTCGGCCATGTCCCCAGCCGC
TTCACCGCCTCCGAGTCGGACAGCCTCGAGCGCAAGCCAGGCGCCATCGTCGTCCCCGCGTCCGCCCCCGCCGAC
CGGGACGCCGCCTACCACGTCGAGCCCGCCGTCGGAGACGCCGCCCGTTTCCCGCCGTACAGCGCCTTCTCGCGA
TCGACCAAGATTTGGGTCACGACCATGGTCACCATCTCGAGCGTCATCTCGCCCATGACGGCCAACGTCTACTTC
CCCGCCCTCAACGCCGTCGCCGACAGCCTCGACGTCTCCATCTCCCTCATCAACCTCACCCTGACCACCTACATG
ATCTTCCAGGGCCTGTCCCCCACCATCTTTGGCGACTTCGGCGACATGGCCGGCCGCCGGCCCGCCTTCATCGTC
GCCTTTCTCATCTATCTCGTCGCCAACATCGGCCTGGCCTTGCAGCGAAACTACGCCGCCCTCATGGTGCTCCGC
TGTCTGCAGTCGGCCGGCAGCAGCGGCACCCTCGCCCTCGGCTACGCCGTCATCGCCGACATCGCGTCCAGGGAG
GAGCGCGGCGTCTACATGGGCCTCGTCAGCGCCGGTGTCAACTTCGGGCCCGCCATCGGCCCCGTCCTGGGCGGC
GTCCTGAGCCAGTACCTCGGCTGGCCCTCCATCTTCTGGTTCTGCGCCATCTTCGTCTTCCTCTGGCTCATCCCC
TGGATACTCTCCGTCCCCGAGACCTGCCGTACCGTCGTCGGCAACGGCTCGATACCCCCGCCCAAGTGGAACATG
ACGCTCATCGACTTCATCCGATGCCGCGGCGTCAACCAGCGACCCGAGTCGGCCCCCCGCGTCAAGCTGCGAGTC
CCCAACCCGCTGCGCACGCTGTACATAGTCTTGCGCAAGGAGGAGGGCCTCATCTTGTTCATCTCGGCCATCATC
TACCTCAACTTCATCTTGGTCTCGGCCACGCTGTCCACCATGTTCAAGAGCATATACTCGTACAACGAGCTCGAG
GTTGGACTCTGCTACCTGCCGTATGGAATCGGCTGCTGTCTCGCCAGCCTCGGCCAGGGATACATCGTCGACTGG
AACTACCGCAGGATGGCCAGCAAGCTCGGCGTGTCCCTGTATCGCAAGTCGGACGAGGACCTCATCAGCTTCCCG
GTCGAGAGCGCCCGCATCCAGCTCGTCTACCCCGCCCTGCTGGTCGGTGCCGCCGCGCTCATCGGCTGGGGGTGG
ACCTTGCAGGTCGAGACCAACGTGGCGGCGCCGCTGGTGCTCCTCTTCATCATTGGCATGCTCGTCCCGACGTCG
TTCAGCGTCCTCAACACGCTCATTGTCGATCTCAACCCGCACGCTCCCGCCACGGCGGCGGCGGCCAACAACTTG
GTGCGCTGCTCCTTCGGCGCGGCGGCGACGGCCGTCATCGATTACATGCTCGAGGCCATGGGCCGCGGCTGGTGC
TTCACCTTCCTCGCCCTCCTCATGATATCCTGCTTCGCCGGGCTGAGAGTGTTGGAGAAGTGCGGCCCCCGCTGG
AGGGCCGAGAGGGCCAGGCTGGCTGGCGGCGGCGACGACAGCCGGACCACGTCGCGAGAAAAGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail