Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8876
Gene name
LocationContig_607:5644..6443
Strand+
Gene length (bp)799
Transcript length (bp)561
Coding sequence length (bp)561
Protein length (aa) 187

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06417 DUF1077 Protein of unknown function (DUF1077) 1.9E-49 60 174

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94520|YQ13_SCHPO ER membrane protein complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1281.03c PE=3 SV=1 32 182 6.0E-31
sp|P53073|EMC4_YEAST ER membrane protein complex subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMC4 PE=1 SV=1 31 173 3.0E-24
sp|Q6GR43|EMC4_XENLA ER membrane protein complex subunit 4 OS=Xenopus laevis GN=emc4 PE=2 SV=1 34 170 5.0E-22
sp|Q6PBF7|EMC4_XENTR ER membrane protein complex subunit 4 OS=Xenopus tropicalis GN=emc4 PE=2 SV=1 34 170 3.0E-21
sp|Q9CZX9|EMC4_MOUSE ER membrane protein complex subunit 4 OS=Mus musculus GN=Emc4 PE=1 SV=1 55 170 2.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94520|YQ13_SCHPO ER membrane protein complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1281.03c PE=3 SV=1 32 182 6.0E-31
sp|P53073|EMC4_YEAST ER membrane protein complex subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMC4 PE=1 SV=1 31 173 3.0E-24
sp|Q6GR43|EMC4_XENLA ER membrane protein complex subunit 4 OS=Xenopus laevis GN=emc4 PE=2 SV=1 34 170 5.0E-22
sp|Q6PBF7|EMC4_XENTR ER membrane protein complex subunit 4 OS=Xenopus tropicalis GN=emc4 PE=2 SV=1 34 170 3.0E-21
sp|Q9CZX9|EMC4_MOUSE ER membrane protein complex subunit 4 OS=Mus musculus GN=Emc4 PE=1 SV=1 55 170 2.0E-20
sp|Q5RC35|EMC4_PONAB ER membrane protein complex subunit 4 OS=Pongo abelii GN=EMC4 PE=2 SV=1 55 170 3.0E-20
sp|Q5J8M3|EMC4_HUMAN ER membrane protein complex subunit 4 OS=Homo sapiens GN=EMC4 PE=1 SV=2 55 170 3.0E-20
sp|Q3T0K8|EMC4_BOVIN ER membrane protein complex subunit 4 OS=Bos taurus GN=EMC4 PE=2 SV=1 55 170 3.0E-20
sp|Q6P011|EMC4_DANRE ER membrane protein complex subunit 4 OS=Danio rerio GN=emc4 PE=2 SV=1 35 170 3.0E-20
sp|B5XB24|EMC4_SALSA ER membrane protein complex subunit 4 OS=Salmo salar GN=emc4 PE=2 SV=1 64 170 1.0E-19
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 86 108 22
2 139 161 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8876
MDEKSPSAPDVPAWVAQLESPPPARAKVSGVPDPVGFSASTPGSKKKDGRSQPPRKAPTSDEMETLKLKKAWEVA
LAPVKSLPMTAIMMYMSGNSLQIFSIMMVFMAFKNPLVGLMSTNQAFERFQTDGNAAKLLQTKLVYVAMQLVALA
VGVWKINAMGLLPTTRSDWLMWETQRASVDRTVTAL*
Coding >Hirsu2|8876
ATGGACGAAAAGTCGCCGTCCGCGCCCGACGTCCCCGCGTGGGTCGCGCAGCTCGAGTCCCCGCCGCCGGCCCGC
GCCAAGGTGTCCGGCGTCCCGGACCCCGTCGGCTTCTCCGCCAGCACGCCCGGCTCCAAGAAAAAGGACGGCCGG
TCGCAGCCGCCGCGCAAGGCCCCGACGTCGGACGAGATGGAGACGCTGAAGCTCAAGAAGGCGTGGGAGGTGGCG
CTCGCGCCTGTCAAGTCGCTGCCCATGACGGCCATCATGATGTACATGTCGGGCAACTCGCTGCAGATCTTCAGC
ATCATGATGGTCTTCATGGCCTTCAAGAACCCCCTCGTCGGCCTGATGAGCACCAACCAGGCCTTTGAGCGGTTC
CAGACCGACGGCAACGCCGCCAAGCTCCTCCAGACCAAGCTCGTCTACGTCGCCATGCAGCTCGTCGCACTGGCC
GTGGGCGTCTGGAAGATCAACGCAATGGGCCTCCTACCGACGACACGGTCGGACTGGTTGATGTGGGAGACGCAA
AGGGCGAGTGTGGATCGGACGGTGACGGCTCTGTAG
Transcript >Hirsu2|8876
ATGGACGAAAAGTCGCCGTCCGCGCCCGACGTCCCCGCGTGGGTCGCGCAGCTCGAGTCCCCGCCGCCGGCCCGC
GCCAAGGTGTCCGGCGTCCCGGACCCCGTCGGCTTCTCCGCCAGCACGCCCGGCTCCAAGAAAAAGGACGGCCGG
TCGCAGCCGCCGCGCAAGGCCCCGACGTCGGACGAGATGGAGACGCTGAAGCTCAAGAAGGCGTGGGAGGTGGCG
CTCGCGCCTGTCAAGTCGCTGCCCATGACGGCCATCATGATGTACATGTCGGGCAACTCGCTGCAGATCTTCAGC
ATCATGATGGTCTTCATGGCCTTCAAGAACCCCCTCGTCGGCCTGATGAGCACCAACCAGGCCTTTGAGCGGTTC
CAGACCGACGGCAACGCCGCCAAGCTCCTCCAGACCAAGCTCGTCTACGTCGCCATGCAGCTCGTCGCACTGGCC
GTGGGCGTCTGGAAGATCAACGCAATGGGCCTCCTACCGACGACACGGTCGGACTGGTTGATGTGGGAGACGCAA
AGGGCGAGTGTGGATCGGACGGTGACGGCTCTGTAG
Gene >Hirsu2|8876
ATGGACGAAAAGTCGCCGTCCGCGCCCGACGTCCCCGCGTGGGTCGCGCAGCTCGAGTCCCCGCCGCCGGCCCGC
GCCAAGGTGTCCGGCGTCCCGGACCCCGTCGGCTTCTCCGCCAGCACGCCCGGCTCCAAGGTGAGAGAGAGTGCT
CTCGCCCGCATCCCCCCAGATAGACGCGCCCCGAGAGAGAGGGAGAGAGGGGGCGGGGGGGGGGGGGGCGGGGGG
GGGGCGATGTCCCCCCTCTCGGTGCTATCTGGAAAATGACGTGTCTAACGGGCCGCGACGCAGAAAAAGGACGGC
CGGTCGCAGCCGCCGCGCAAGGCCCCGACGTCGGACGAGATGGAGACGCTGAAGCTCAAGAAGGCGTGGGAGGTG
GCGCTCGCGCCTGTCAAGTCGCTGCCCATGACGGCCATCATGATGTACATGTCGGGCAACTCGCTGCAGATCTTC
AGCATCATGATGGTCTTCATGGCCTTCAAGAACCCCCTCGTCGGCCTGATGAGCACCAACCAGGCCTTTGAGCGG
TTCCAGACCGACGGCAACGCCGCCAAGCTCCTCCAGACCAAGCTCGTCTACGTCGCCATGCAGCTCGTCGCACTG
GCCGTGGGCGTCTGGAAGATCAACGCAATGGGCCTCCTACCGTGCGTCTCCCCTCCTTTCCTCCTCCCGCAAAAC
CAGATGAGGCTTGCCTTATCCCGCACCGGCGCTGACTCTGACACAAATCAGGACGACACGGTCGGACTGGTTGAT
GTGGGAGACGCAAAGGGCGAGTGTGGATCGGACGGTGACGGCTCTGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail