Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8871
Gene name
LocationContig_605:12626..14618
Strand+
Gene length (bp)1992
Transcript length (bp)1704
Coding sequence length (bp)1704
Protein length (aa) 568

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 1.8E-45 60 544
PF07690 MFS_1 Major Facilitator Superfamily 9.6E-17 106 491

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RVX9|PHO5_NEUCR Repressible high-affinity phosphate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pho-5 PE=1 SV=2 15 558 0.0E+00
sp|P25297|PHO84_YEAST Inorganic phosphate transporter PHO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO84 PE=1 SV=2 16 545 0.0E+00
sp|Q9ZWT3|PHT16_ARATH Probable inorganic phosphate transporter 1-6 OS=Arabidopsis thaliana GN=PHT1-6 PE=1 SV=1 37 549 2.0E-110
sp|Q8H6H2|PHT14_ORYSJ Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. japonica GN=PHT1-4 PE=2 SV=1 44 564 1.0E-108
sp|Q01MW8|PHT14_ORYSI Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. indica GN=PHT1-4 PE=2 SV=2 44 564 1.0E-107
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RVX9|PHO5_NEUCR Repressible high-affinity phosphate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pho-5 PE=1 SV=2 15 558 0.0E+00
sp|P25297|PHO84_YEAST Inorganic phosphate transporter PHO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO84 PE=1 SV=2 16 545 0.0E+00
sp|Q9ZWT3|PHT16_ARATH Probable inorganic phosphate transporter 1-6 OS=Arabidopsis thaliana GN=PHT1-6 PE=1 SV=1 37 549 2.0E-110
sp|Q8H6H2|PHT14_ORYSJ Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. japonica GN=PHT1-4 PE=2 SV=1 44 564 1.0E-108
sp|Q01MW8|PHT14_ORYSI Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. indica GN=PHT1-4 PE=2 SV=2 44 564 1.0E-107
sp|Q8GSD9|PHT12_ORYSJ Inorganic phosphate transporter 1-2 OS=Oryza sativa subsp. japonica GN=PTH1-2 PE=2 SV=1 44 548 3.0E-107
sp|Q7X7V2|PHT15_ORYSJ Probable inorganic phosphate transporter 1-5 OS=Oryza sativa subsp. japonica GN=PHT1-5 PE=2 SV=2 39 564 6.0E-106
sp|Q8H6H0|PHT16_ORYSJ Inorganic phosphate transporter 1-6 OS=Oryza sativa subsp. japonica GN=PHT1-6 PE=1 SV=1 38 557 3.0E-105
sp|Q8VYM2|PHT11_ARATH Inorganic phosphate transporter 1-1 OS=Arabidopsis thaliana GN=PHT1-1 PE=1 SV=2 36 549 2.0E-104
sp|Q94DB8|PT111_ORYSJ Inorganic phosphate transporter 1-11 OS=Oryza sativa subsp. japonica GN=PHT1-11 PE=2 SV=1 33 548 7.0E-103
sp|O48639|PHT13_ARATH Probable inorganic phosphate transporter 1-3 OS=Arabidopsis thaliana GN=PHT1-3 PE=2 SV=1 44 549 1.0E-102
sp|Q8H6G9|PHT17_ORYSJ Probable inorganic phosphate transporter 1-7 OS=Oryza sativa subsp. japonica GN=PHT1-7 PE=2 SV=1 44 549 1.0E-102
sp|Q494P0|PHT17_ARATH Probable inorganic phosphate transporter 1-7 OS=Arabidopsis thaliana GN=PHT1-7 PE=2 SV=2 44 549 2.0E-102
sp|Q8GYF4|PHT15_ARATH Probable inorganic phosphate transporter 1-5 OS=Arabidopsis thaliana GN=PHT1-5 PE=2 SV=2 36 549 1.0E-101
sp|Q8H074|PT112_ORYSJ Probable inorganic phosphate transporter 1-12 OS=Oryza sativa subsp. japonica GN=PHT1-12 PE=2 SV=1 37 549 2.0E-101
sp|Q96303|PHT14_ARATH Inorganic phosphate transporter 1-4 OS=Arabidopsis thaliana GN=PHT1-4 PE=1 SV=1 39 546 6.0E-101
sp|Q7XDZ7|PHT13_ORYSJ Probable inorganic phosphate transporter 1-3 OS=Oryza sativa subsp. japonica GN=PHT1-3 PE=2 SV=1 44 548 2.0E-99
sp|Q9S735|PHT19_ARATH Probable inorganic phosphate transporter 1-9 OS=Arabidopsis thaliana GN=PHT1-9 PE=2 SV=1 44 563 8.0E-97
sp|Q8H6G8|PHT18_ORYSJ Probable inorganic phosphate transporter 1-8 OS=Oryza sativa subsp. japonica GN=PHT1-8 PE=2 SV=1 37 549 2.0E-96
sp|Q7XRH8|PT113_ORYSJ Putative inorganic phosphate transporter 1-13 OS=Oryza sativa subsp. japonica GN=PHT1-13 PE=3 SV=2 37 546 6.0E-95
sp|Q96243|PHT12_ARATH Probable inorganic phosphate transporter 1-2 OS=Arabidopsis thaliana GN=PHT1-2 PE=2 SV=2 36 549 9.0E-95
sp|Q8H6H4|PHT11_ORYSJ Inorganic phosphate transporter 1-1 OS=Oryza sativa subsp. japonica GN=PHT1-1 PE=2 SV=1 44 554 1.0E-93
sp|Q9SYQ1|PHT18_ARATH Probable inorganic phosphate transporter 1-8 OS=Arabidopsis thaliana GN=PHT1-8 PE=2 SV=2 44 557 1.0E-93
sp|O42885|YBN1_SCHPO Putative inorganic phosphate transporter C8E4.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC8E4.01c PE=1 SV=2 21 545 5.0E-89
sp|Q9P6J9|YHD1_SCHPO Putative inorganic phosphate transporter C1683.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.01 PE=3 SV=1 58 544 2.0E-88
sp|Q9Y7Q9|YCX2_SCHPO Probable metabolite transporter C2H8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC2H8.02 PE=1 SV=1 56 539 3.0E-84
sp|Q09852|YAEC_SCHPO Putative inorganic phosphate transporter C23D3.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23D3.12 PE=1 SV=1 32 548 2.0E-83
sp|Q69T94|PT110_ORYSJ Probable inorganic phosphate transporter 1-10 OS=Oryza sativa subsp. japonica GN=PHT1-10 PE=2 SV=1 44 557 2.0E-83
sp|Q8H6G7|PHT19_ORYSJ Probable inorganic phosphate transporter 1-9 OS=Oryza sativa subsp. japonica GN=PHT1-9 PE=2 SV=2 44 543 1.0E-77
sp|P31679|YAAU_ECOLI Putative metabolite transport protein YaaU OS=Escherichia coli (strain K12) GN=yaaU PE=3 SV=2 48 495 4.0E-25
sp|O34691|NAIP_BACSU Putative niacin/nicotinamide transporter NaiP OS=Bacillus subtilis (strain 168) GN=naiP PE=1 SV=1 62 543 1.0E-17
sp|O94342|YHM9_SCHPO Probable metabolite transport protein C1271.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.09 PE=3 SV=1 54 543 5.0E-17
sp|Q6A4L0|S22AD_MOUSE Solute carrier family 22 member 13 OS=Mus musculus GN=Slc22a13 PE=1 SV=3 109 490 2.0E-11
sp|Q9U539|OCT1_CAEEL Organic cation transporter 1 OS=Caenorhabditis elegans GN=oct-1 PE=1 SV=3 103 565 4.0E-11
sp|Q9Y226|S22AD_HUMAN Solute carrier family 22 member 13 OS=Homo sapiens GN=SLC22A13 PE=2 SV=2 109 559 4.0E-11
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 47 490 2.0E-10
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 47 490 2.0E-10
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 164 545 3.0E-10
sp|P30638|SVOP_CAEEL Putative transporter svop-1 OS=Caenorhabditis elegans GN=svop-1 PE=3 SV=5 28 490 6.0E-10
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 47 490 8.0E-10
sp|P25346|GIT1_YEAST Probable metabolite transport protein GIT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIT1 PE=1 SV=1 27 499 9.0E-10
sp|O15245|S22A1_HUMAN Solute carrier family 22 member 1 OS=Homo sapiens GN=SLC22A1 PE=1 SV=2 108 553 2.0E-09
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 110 553 5.0E-09
sp|P28568|GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus GN=SLC2A3 PE=2 SV=1 108 559 7.0E-09
sp|Q2XWK0|SVOP_XENLA Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1 47 490 8.0E-09
sp|P0AGF4|XYLE_ECOLI D-xylose-proton symporter OS=Escherichia coli (strain K12) GN=xylE PE=1 SV=1 110 565 2.0E-08
sp|P0AGF5|XYLE_ECO57 D-xylose-proton symporter OS=Escherichia coli O157:H7 GN=xylE PE=3 SV=1 110 565 2.0E-08
sp|Q9VCA2|ORCT_DROME Organic cation transporter protein OS=Drosophila melanogaster GN=Orct PE=1 SV=1 110 559 3.0E-08
sp|C7GWV6|HXT4_YEAS2 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain JAY291) GN=HXT4 PE=3 SV=1 2 545 3.0E-08
sp|Q8BFT9|SVOP_MOUSE Synaptic vesicle 2-related protein OS=Mus musculus GN=Svop PE=1 SV=1 47 490 4.0E-08
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 28 561 4.0E-08
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 110 545 6.0E-08
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 110 545 6.0E-08
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 108 563 6.0E-08
sp|Q5R540|S22A7_PONAB Solute carrier family 22 member 7 OS=Pongo abelii GN=SLC22A7 PE=2 SV=1 109 487 8.0E-08
sp|Q9Z2I7|SVOP_RAT Synaptic vesicle 2-related protein OS=Rattus norvegicus GN=Svop PE=1 SV=1 47 548 9.0E-08
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 108 554 9.0E-08
sp|Q9Y694|S22A7_HUMAN Solute carrier family 22 member 7 OS=Homo sapiens GN=SLC22A7 PE=1 SV=1 109 487 1.0E-07
sp|A6ZT02|HXT4_YEAS7 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain YJM789) GN=HXT4 PE=3 SV=1 2 545 1.0E-07
sp|P32467|HXT4_YEAST Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT4 PE=1 SV=1 2 545 1.0E-07
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 110 549 2.0E-07
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 108 563 2.0E-07
sp|Q91WU2|S22A7_MOUSE Solute carrier family 22 member 7 OS=Mus musculus GN=Slc22a7 PE=1 SV=1 110 543 2.0E-07
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 110 548 3.0E-07
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 108 554 3.0E-07
sp|A6QLW8|S22A7_BOVIN Solute carrier family 22 member 7 OS=Bos taurus GN=SLC22A7 PE=2 SV=1 100 487 4.0E-07
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 112 486 4.0E-07
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 55 439 5.0E-07
sp|Q8HY24|S22A8_RABIT Solute carrier family 22 member 8 OS=Oryctolagus cuniculus GN=SLC22A8 PE=2 SV=1 98 566 7.0E-07
sp|Q8WMN1|GTR5_SHEEP Solute carrier family 2, facilitated glucose transporter member 5 OS=Ovis aries GN=SLC2A5 PE=2 SV=1 110 312 7.0E-07
sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2 62 544 7.0E-07
sp|P96710|ARAE_BACSU Arabinose-proton symporter OS=Bacillus subtilis (strain 168) GN=araE PE=2 SV=2 209 545 1.0E-06
sp|Q46909|YGCS_ECOLI Inner membrane metabolite transport protein YgcS OS=Escherichia coli (strain K12) GN=ygcS PE=1 SV=2 46 495 1.0E-06
sp|Q1RPP5|S22A7_PIG Solute carrier family 22 member 7 OS=Sus scrofa GN=SLC22A7 PE=2 SV=1 109 487 1.0E-06
sp|Q29397|SV2A_BOVIN Synaptic vesicle glycoprotein 2A OS=Bos taurus GN=SV2A PE=2 SV=1 95 357 1.0E-06
sp|Q5R4L9|SV2A_PONAB Synaptic vesicle glycoprotein 2A OS=Pongo abelii GN=SV2A PE=2 SV=1 95 357 1.0E-06
sp|Q7L0J3|SV2A_HUMAN Synaptic vesicle glycoprotein 2A OS=Homo sapiens GN=SV2A PE=1 SV=1 95 357 1.0E-06
sp|P23585|HXT2_YEAST High-affinity glucose transporter HXT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT2 PE=1 SV=1 110 491 2.0E-06
sp|Q4R4X3|SV2A_MACFA Synaptic vesicle glycoprotein 2A OS=Macaca fascicularis GN=SV2A PE=2 SV=1 95 357 2.0E-06
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 110 473 2.0E-06
sp|P0C0L7|PROP_ECOLI Proline/betaine transporter OS=Escherichia coli (strain K12) GN=proP PE=1 SV=1 58 288 2.0E-06
sp|P0C0L8|PROP_ECO57 Proline/betaine transporter OS=Escherichia coli O157:H7 GN=proP PE=3 SV=1 58 288 2.0E-06
sp|Q9LNV3|STP2_ARATH Sugar transport protein 2 OS=Arabidopsis thaliana GN=STP2 PE=1 SV=3 59 558 2.0E-06
sp|P58353|GTR5_BOVIN Solute carrier family 2, facilitated glucose transporter member 5 OS=Bos taurus GN=SLC2A5 PE=1 SV=2 110 312 3.0E-06
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 110 545 3.0E-06
sp|P0AE25|ARAE_ECO57 Arabinose-proton symporter OS=Escherichia coli O157:H7 GN=araE PE=3 SV=1 110 545 3.0E-06
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 94 544 4.0E-06
sp|Q9JIS5|SV2A_MOUSE Synaptic vesicle glycoprotein 2A OS=Mus musculus GN=Sv2a PE=1 SV=1 95 357 7.0E-06
sp|Q02563|SV2A_RAT Synaptic vesicle glycoprotein 2A OS=Rattus norvegicus GN=Sv2a PE=1 SV=2 95 357 7.0E-06
sp|P37514|YYAJ_BACSU Putative metabolite transport protein YyaJ OS=Bacillus subtilis (strain 168) GN=yyaJ PE=3 SV=2 46 492 8.0E-06
sp|Q07423|HEX6_RICCO Hexose carrier protein HEX6 OS=Ricinus communis GN=HEX6 PE=2 SV=1 159 544 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

Domain # Start End Length
1 74 96 22
2 103 125 22
3 130 149 19
4 156 178 22
5 198 220 22
6 247 266 19
7 335 357 22
8 377 399 22
9 414 436 22
10 441 463 22
11 515 534 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8871
MAVSPASSPSAAAAKTSGGNSAYHNFHNDFVHVADLNERRRLALAEVDRAPFGWYHVRACVVAGVGFFTDSYDIF
TASLLTIMLGIVYYPGSGVMPTSSDNAIKLATSAGTVVGQLGFGYLADVVGRKRMYGLELIVIIFATLGQALTSN
SPACDIIGLIIFWRVIMGVGIGGDYPLSSIITSEFATTKWRGAMMASVFAMQGLGQLGAALVMLFATLGFRSQLE
GAADVARCDGECRIAVDKMWRLLIGFGAVPACIALYFRLTIPETPRYTFDVARDVEKAQDDVKAYMSGKHEGDPD
ALVQVATSRAARDRLEVPKASWADFFRHYGELKNFLLLFGTAGSWFCLDVAFYGLSLNNGAILSVIGYSTKNARS
VYQFLYNTAVGNLVIVLAGAVPGYWVSVGTIDILGRKKIQMGGFVILTVLFVVMGFAYFSLSANGLLAIYVVAQF
FFNFGPNTTTFIVPGEVFPTRYRSTSHGISAAAGKIGSIIGQGAISTLRTRGATKDNPAPWMDHVLEIYALFMLL
GCFTTLLIPETARRTLEELSGEDDYAARPPAQRSRRTQPLNC*
Coding >Hirsu2|8871
ATGGCCGTCTCCCCGGCCAGCTCGCCCTCGGCCGCGGCCGCCAAAACGTCGGGCGGCAACAGTGCCTATCACAAC
TTCCACAACGACTTCGTCCATGTCGCCGACCTCAACGAGCGCCGGAGGCTAGCCCTCGCCGAGGTCGACCGGGCG
CCCTTCGGCTGGTACCATGTGCGGGCCTGCGTCGTCGCCGGCGTCGGCTTCTTCACCGACTCGTACGACATCTTC
ACGGCCTCGCTGCTGACCATCATGCTCGGCATCGTCTACTACCCGGGCTCGGGCGTCATGCCGACCAGCTCCGAC
AACGCCATCAAGCTCGCCACCTCGGCCGGCACCGTCGTCGGCCAGCTCGGCTTCGGCTACCTCGCCGACGTCGTC
GGCCGCAAGCGCATGTACGGCCTGGAGCTCATCGTCATCATCTTCGCCACCCTCGGCCAGGCCCTGACCAGCAAC
TCGCCCGCCTGCGACATCATCGGCCTCATCATCTTCTGGCGCGTCATCATGGGCGTCGGCATCGGCGGTGACTAC
CCATTGTCTTCCATCATCACCTCGGAGTTCGCGACGACCAAGTGGAGAGGCGCGATGATGGCGTCCGTCTTTGCC
ATGCAGGGACTCGGCCAGCTCGGCGCCGCGCTCGTCATGCTCTTCGCCACGCTCGGCTTCCGGTCGCAGCTCGAG
GGCGCCGCCGACGTGGCGCGCTGCGACGGCGAGTGCCGCATCGCCGTCGACAAGATGTGGCGGCTCCTCATCGGC
TTCGGCGCCGTCCCGGCCTGCATCGCCCTGTACTTCCGGCTCACCATCCCCGAGACGCCGCGGTACACGTTTGAC
GTGGCTCGCGACGTGGAGAAGGCGCAGGACGACGTCAAGGCCTACATGTCCGGCAAGCACGAGGGCGACCCGGAC
GCGCTGGTGCAGGTGGCCACGAGCCGCGCGGCCCGGGACCGGCTCGAGGTGCCCAAGGCCAGCTGGGCCGACTTC
TTCCGCCACTACGGCGAGCTCAAGAACTTCCTGCTTCTCTTCGGCACGGCCGGCTCCTGGTTCTGCCTGGACGTG
GCCTTCTACGGCCTGTCGCTCAACAACGGCGCCATCCTCAGCGTCATCGGCTACTCGACCAAGAACGCGCGCAGC
GTCTACCAGTTCCTCTACAACACGGCCGTCGGCAACCTCGTCATCGTCCTGGCCGGCGCCGTGCCCGGCTACTGG
GTCTCCGTCGGCACCATCGACATCCTCGGCCGCAAGAAGATCCAGATGGGCGGCTTCGTCATCCTGACCGTCCTC
TTCGTCGTCATGGGCTTCGCCTACTTTTCCCTCTCGGCCAACGGCCTGCTGGCCATCTACGTCGTCGCCCAGTTC
TTCTTCAACTTTGGCCCCAACACGACGACCTTCATCGTCCCCGGCGAGGTGTTCCCGACGCGCTACCGCTCCACC
TCGCACGGTATCTCCGCCGCCGCCGGCAAGATCGGCTCCATCATCGGCCAGGGCGCCATCTCGACGCTGCGCACC
CGCGGCGCCACCAAGGACAACCCGGCCCCCTGGATGGACCACGTGCTCGAGATCTACGCCCTCTTCATGCTCCTC
GGCTGCTTCACCACCCTGCTCATCCCCGAGACGGCCCGCCGCACGCTCGAGGAGCTCAGCGGCGAGGACGACTAC
GCCGCCCGCCCGCCCGCCCAGCGAAGCAGGCGAACCCAACCACTAAACTGCTAA
Transcript >Hirsu2|8871
ATGGCCGTCTCCCCGGCCAGCTCGCCCTCGGCCGCGGCCGCCAAAACGTCGGGCGGCAACAGTGCCTATCACAAC
TTCCACAACGACTTCGTCCATGTCGCCGACCTCAACGAGCGCCGGAGGCTAGCCCTCGCCGAGGTCGACCGGGCG
CCCTTCGGCTGGTACCATGTGCGGGCCTGCGTCGTCGCCGGCGTCGGCTTCTTCACCGACTCGTACGACATCTTC
ACGGCCTCGCTGCTGACCATCATGCTCGGCATCGTCTACTACCCGGGCTCGGGCGTCATGCCGACCAGCTCCGAC
AACGCCATCAAGCTCGCCACCTCGGCCGGCACCGTCGTCGGCCAGCTCGGCTTCGGCTACCTCGCCGACGTCGTC
GGCCGCAAGCGCATGTACGGCCTGGAGCTCATCGTCATCATCTTCGCCACCCTCGGCCAGGCCCTGACCAGCAAC
TCGCCCGCCTGCGACATCATCGGCCTCATCATCTTCTGGCGCGTCATCATGGGCGTCGGCATCGGCGGTGACTAC
CCATTGTCTTCCATCATCACCTCGGAGTTCGCGACGACCAAGTGGAGAGGCGCGATGATGGCGTCCGTCTTTGCC
ATGCAGGGACTCGGCCAGCTCGGCGCCGCGCTCGTCATGCTCTTCGCCACGCTCGGCTTCCGGTCGCAGCTCGAG
GGCGCCGCCGACGTGGCGCGCTGCGACGGCGAGTGCCGCATCGCCGTCGACAAGATGTGGCGGCTCCTCATCGGC
TTCGGCGCCGTCCCGGCCTGCATCGCCCTGTACTTCCGGCTCACCATCCCCGAGACGCCGCGGTACACGTTTGAC
GTGGCTCGCGACGTGGAGAAGGCGCAGGACGACGTCAAGGCCTACATGTCCGGCAAGCACGAGGGCGACCCGGAC
GCGCTGGTGCAGGTGGCCACGAGCCGCGCGGCCCGGGACCGGCTCGAGGTGCCCAAGGCCAGCTGGGCCGACTTC
TTCCGCCACTACGGCGAGCTCAAGAACTTCCTGCTTCTCTTCGGCACGGCCGGCTCCTGGTTCTGCCTGGACGTG
GCCTTCTACGGCCTGTCGCTCAACAACGGCGCCATCCTCAGCGTCATCGGCTACTCGACCAAGAACGCGCGCAGC
GTCTACCAGTTCCTCTACAACACGGCCGTCGGCAACCTCGTCATCGTCCTGGCCGGCGCCGTGCCCGGCTACTGG
GTCTCCGTCGGCACCATCGACATCCTCGGCCGCAAGAAGATCCAGATGGGCGGCTTCGTCATCCTGACCGTCCTC
TTCGTCGTCATGGGCTTCGCCTACTTTTCCCTCTCGGCCAACGGCCTGCTGGCCATCTACGTCGTCGCCCAGTTC
TTCTTCAACTTTGGCCCCAACACGACGACCTTCATCGTCCCCGGCGAGGTGTTCCCGACGCGCTACCGCTCCACC
TCGCACGGTATCTCCGCCGCCGCCGGCAAGATCGGCTCCATCATCGGCCAGGGCGCCATCTCGACGCTGCGCACC
CGCGGCGCCACCAAGGACAACCCGGCCCCCTGGATGGACCACGTGCTCGAGATCTACGCCCTCTTCATGCTCCTC
GGCTGCTTCACCACCCTGCTCATCCCCGAGACGGCCCGCCGCACGCTCGAGGAGCTCAGCGGCGAGGACGACTAC
GCCGCCCGCCCGCCCGCCCAGCGAAGCAGGCGAACCCAACCACTAAACTGCTAA
Gene >Hirsu2|8871
ATGGCCGTCTCCCCGGCCAGCTCGCCCTCGGCCGCGGCCGCCAAAACGTCGGGCGGCAACAGTGCCTATCACAAC
TTCCACAACGACTTCGTCCATGTCGCCGACCTCAACGAGCGCCGGAGGCTAGCCCTCGCCGAGGTCGACCGGGCG
CCCTTCGGCTGGTACCATGTGCGGGCCTGCGTCGTCGCCGGCGTCGGCTTCTTCACCGACTCGTACGACATCTTC
ACGGCCTCGCTGCTGACCATCATGCTCGGCATCGTCTACTACCCGGGCTCGGGCGTCATGCCGACCAGCTCCGAC
AACGCCATCAAGCTCGCCACCTCGGCCGGCACCGTCGTCGGCCAGCTCGGCTTCGGCTACCTCGCCGACGTCGTC
GGCCGCAAGCGCATGTACGGCCTGGAGCTCATCGTCATCATCTTCGCCACCCTCGGCCAGGCCCTGACCAGCAAC
TCGCCCGCCTGCGACATCATCGGCCTCATCATCTTCTGGCGCGTCATCATGGGCGTCGGCATCGGCGGTGACTAC
CCATTGTCTTCCATCATCACCTCGGAGTATGTCCCTGCTCCTTGCTCACCTCCCTCTCTCTCTCTCTCTCTCGCC
CCGACCTCCTGACAAACCGGCGCCTTTCGCCAGGTTCGCGACGACCAAGTGGAGAGGCGCGATGATGGCGTCCGT
CTTTGCCATGCAGGGACTCGGCCAGCTCGGCGCCGCGCTCGTCATGCTCTTCGCCACGCTCGGCTTCCGGTCGCA
GCTCGAGGGCGCCGCCGACGTGGCGCGCTGCGACGGCGAGTGCCGCATCGCCGTCGACAAGATGTGGCGGCTCCT
CATCGGCTTCGGCGCCGTCCCGGCCTGCATCGCCCTGTACTGTATGTTGGTTGCGAAAGACCGGACTCCCTCGTG
TCTCCCCCCTCGTCGACGGACGGGCTGCTGACCGGTCACCCGCCGCCGACAGTCCGGCTCACCATCCCCGAGACG
CCGCGGTACACGTTTGACGTGGCTCGCGACGTGGAGAAGGCGCAGGACGACGTCAAGGCCTACATGTCCGGCAAG
CACGAGGGCGACCCGGACGCGCTGGTGCAGGTGGCCACGAGCCGCGCGGCCCGGGACCGGCTCGAGGTGCCCAAG
GCCAGCTGGGCCGACTTCTTCCGCCACTACGGCGAGCTCAAGAACTTCCTGCTTCTCTTCGGCACGGCCGGCTCC
TGGTTCTGCCTGGACGTGGCCTTCTACGGCCTGTCGCTCAACAACGGCGCCATCCTCAGCGTCATCGGCTACTCG
ACCAAGAACGCGCGCAGCGTCTACCAGTTCCTCTACAACACGGCCGTCGGCAACCTCGTCATCGTCCTGGCCGGC
GCCGTGCCCGGCTACTGGGTCTCCGTCGGCACCATCGACATCCTCGGCCGCAAGAAGATCCAGATGGGCGGCTTC
GTCATCCTGACCGTCCTCTTCGTCGTCATGGGCTTCGCCTACTTTTCCCTCTCGGCCAACGGCCTGCTGGCCATC
TACGTCGTCGCCCAGTTCTTCTTCAACTTTGGTGCGTGAACCCCCCCCCTCTCCGCCTCGTCCAATTCTCCCGGC
CGCGGCCGACGCATCTTCTTCCTCTTCTTCCCTCCCTCCTGACGCTTGCTTGCCCCCGCCCCCTCCCCTCCTACA
GGCCCCAACACGACGACCTTCATCGTCCCCGGCGAGGTGTTCCCGACGCGCTACCGCTCCACCTCGCACGGTATC
TCCGCCGCCGCCGGCAAGATCGGCTCCATCATCGGCCAGGGCGCCATCTCGACGCTGCGCACCCGCGGCGCCACC
AAGGACAACCCGGCCCCCTGGATGGACCACGTGCTCGAGATCTACGCCCTCTTCATGCTCCTCGGCTGCTTCACC
ACCCTGCTCATCCCCGAGACGGCCCGCCGCACGCTCGAGGAGCTCAGCGGCGAGGACGACTACGCCGCCCGCCCG
CCCGCCCAGCGAAGCAGGCGAACCCAACCACTAAACTGCTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail