Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|887
Gene name
LocationContig_1186:1509..4087
Strand-
Gene length (bp)2578
Transcript length (bp)2514
Coding sequence length (bp)2514
Protein length (aa) 838

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P11551|FUCP_ECOLI L-fucose-proton symporter OS=Escherichia coli (strain K12) GN=fucP PE=1 SV=3 364 809 5.0E-17
sp|P44776|FUCP_HAEIN L-fucose permease OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fucP PE=3 SV=1 383 558 6.0E-12
sp|P0C105|GLUP_BRUAB Glucose/galactose transporter OS=Brucella abortus biovar 1 (strain 9-941) GN=gluP PE=3 SV=1 387 785 1.0E-10
sp|Q2YIJ8|GLUP_BRUA2 Glucose/galactose transporter OS=Brucella abortus (strain 2308) GN=gluP PE=3 SV=1 387 785 1.0E-10
sp|Q8YB48|GLUP_BRUME Glucose/galactose transporter OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gluP PE=3 SV=1 387 785 4.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 50 72 22
3 92 114 22
4 129 151 22
5 172 194 22
6 209 231 22
7 386 408 22
8 418 440 22
9 453 475 22
10 490 512 22
11 560 582 22
12 669 691 22
13 703 720 17
14 730 749 19
15 761 783 22
16 788 810 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|887
MAATGDEEQRGRLIFAVTISTLGLATMLVGARTVSRFFIVRRVTWDDKVMILAWFLASGLSFTVSLGAFHGLGKS
EADISDESKRILLRCEYVFSILYNPALMATKTAILIFYLHLANNTQLFLRYASWTVLAISNLAGFILTVINIFQC
TPIQAAWTLYTFDETASCIPLLTEFICVTPINIITDLAILVLPIPLLTNLRLPIRQKTVLVLAFALGVFVTVIGV
IRIYYLQCAILDDSPEEDGAPMQNITTLGGQADFSRSASFALMWSTVEVNIGIACACIPTIKPLIAKLFPRLLND
SPGNRSQASIDSQLTLCPSQSTSSNLTPSAKKAATMKEKQLEDEFETPPASPCDNTLFGFVNMTKPINMIDASVA
ESFRFCAMISSLFFLWGVSYGLIDAINHAVALVSNITTAQSIGLSAAYFGGGYFFGPLFATRFLLRRGRDGVLSC
DDVGGYKLTFITGICIYGVGTISFWPSAALSSYPGFLLSNLIAGFGLAVLEVGANAYIILCGPPDYGQSRLLVAQ
GIQGLGSVVSSLLGQKVLLTGIVAGDSKALINIQWVYLGATLMCALIGLLFYYAPLPEATDDELDQLAGRLQVDP
CKHVIGGLQLRTASLVLAVFTQYMYVATQETNHLFMRPLLLSSFGVDISRGESNTDQPPGMTLTIPDYLLLGRTA
FTISRLLFGYLTYLSASRPRLPRPHTYLAMCVVASLVLSVVRVVVNPSNPNLRVIPIVLMFFVEAPMWPLLFALG
LRGQGRRTSTAAALLTMGGSGSALIPYAMYAIVQAGATVQAAYVVVVAVQATLTLYPAFLTLNRDARRLAEPYSA
ARHPRRTSRDGT*
Coding >Hirsu2|887
ATGGCCGCCACCGGTGACGAGGAGCAGCGTGGGCGGCTCATCTTTGCCGTCACCATTTCCACGCTTGGCCTCGCC
ACCATGCTCGTCGGCGCCCGCACCGTGAGCCGCTTCTTCATCGTCCGTAGGGTCACCTGGGACGACAAGGTCATG
ATCTTGGCCTGGTTTCTCGCCTCCGGCCTCTCATTCACCGTCAGCCTCGGCGCCTTCCACGGCCTGGGAAAATCC
GAGGCCGATATTTCGGATGAGAGCAAGCGCATCCTTCTCCGGTGCGAATACGTCTTCTCCATCTTATACAACCCG
GCCCTCATGGCCACCAAGACGGCCATCTTGATATTCTATCTCCACCTTGCAAACAACACCCAGCTGTTCCTGCGC
TATGCCTCATGGACCGTCCTGGCCATCAGCAACCTCGCCGGCTTCATCCTCACCGTCATCAACATCTTCCAGTGC
ACCCCGATCCAGGCGGCCTGGACTCTGTACACCTTCGACGAGACCGCCTCATGCATACCGCTCCTCACCGAGTTT
ATCTGCGTTACGCCTATTAATATTATCACAGACCTGGCCATTCTCGTCTTACCCATCCCGCTCCTCACCAATCTA
CGGCTGCCGATCCGGCAGAAGACGGTTCTCGTACTAGCCTTTGCCCTCGGCGTCTTCGTCACCGTCATCGGCGTC
ATCCGCATCTACTACCTGCAGTGCGCTATCCTGGACGACTCGCCGGAGGAAGACGGAGCGCCGATGCAGAATATT
ACGACGCTCGGCGGTCAGGCCGATTTCTCGAGGAGCGCCTCCTTCGCCTTGATGTGGAGCACAGTCGAGGTCAAC
ATCGGCATCGCCTGTGCCTGCATCCCGACTATCAAGCCGCTCATCGCCAAGCTGTTCCCCAGGTTACTGAACGAC
AGTCCCGGCAACCGGTCGCAGGCTTCCATCGACTCTCAGCTGACGCTGTGCCCGAGCCAGTCGACGTCGTCGAAC
CTGACGCCGTCGGCCAAGAAGGCGGCCACGATGAAGGAGAAGCAGCTGGAGGACGAGTTTGAGACGCCGCCGGCG
AGTCCCTGCGACAACACCCTCTTCGGCTTCGTCAACATGACCAAGCCGATCAACATGATCGATGCTAGCGTGGCA
GAGTCCTTCCGCTTCTGTGCCATGATCTCCTCCCTCTTCTTCCTCTGGGGCGTGTCGTACGGCCTGATCGATGCC
ATCAACCACGCCGTGGCCCTGGTCAGCAACATCACGACGGCCCAGTCCATCGGCCTGTCGGCCGCCTACTTTGGC
GGCGGCTACTTCTTCGGGCCCCTCTTCGCCACCCGGTTCCTCCTGCGGCGCGGGCGCGACGGCGTCCTGTCGTGC
GACGACGTGGGCGGCTACAAGCTGACCTTCATCACCGGCATCTGCATCTACGGCGTCGGCACCATCTCCTTCTGG
CCGTCGGCGGCCCTGTCGTCCTACCCCGGCTTCTTGCTCAGCAACCTCATCGCCGGCTTCGGCTTGGCCGTCCTC
GAGGTCGGCGCCAACGCCTACATCATCCTGTGTGGGCCGCCCGACTACGGCCAGTCGCGGCTCCTGGTGGCCCAG
GGGATCCAGGGGCTGGGCAGCGTCGTCAGCAGCCTGCTGGGGCAAAAGGTGCTGCTCACGGGCATCGTCGCCGGC
GACAGCAAGGCGCTCATCAACATCCAATGGGTCTACCTGGGCGCGACGCTCATGTGCGCCCTCATCGGCCTCTTG
TTCTACTACGCGCCCTTGCCCGAGGCCACCGACGATGAGCTCGACCAGCTGGCGGGCCGCCTCCAGGTCGACCCG
TGCAAGCACGTCATCGGCGGCCTGCAGCTGCGCACGGCGAGCCTCGTCCTGGCCGTCTTCACGCAGTACATGTAC
GTGGCGACGCAGGAGACCAACCACCTCTTCATGCGGCCCCTCCTCCTCTCCAGCTTCGGCGTCGACATCAGCCGG
GGGGAAAGCAATACGGACCAGCCGCCGGGCATGACGCTGACGATCCCCGACTACCTGCTGCTCGGACGCACGGCC
TTTACCATCTCCCGCCTCCTCTTCGGCTACCTGACCTATCTGTCGGCCTCGCGTCCCCGACTGCCCAGGCCGCAC
ACGTATCTCGCCATGTGCGTGGTCGCGAGCCTGGTCCTGTCCGTCGTCCGCGTCGTGGTCAACCCGTCGAACCCC
AACCTGCGCGTCATCCCTATCGTGCTGATGTTCTTCGTCGAGGCCCCCATGTGGCCGCTGCTGTTCGCGCTCGGC
CTGCGCGGGCAGGGGCGGAGGACGTCCACGGCGGCGGCGCTGCTCACGATGGGCGGCTCCGGGTCGGCGCTGATC
CCGTACGCCATGTACGCCATCGTCCAGGCCGGCGCCACGGTGCAGGCCGCCTACGTGGTCGTCGTTGCCGTGCAG
GCCACGCTCACATTGTACCCCGCCTTTCTCACGCTCAACCGGGACGCGAGACGACTGGCCGAGCCGTATTCCGCT
GCGCGGCATCCGAGGCGAACGAGCCGAGACGGCACCTGA
Transcript >Hirsu2|887
ATGGCCGCCACCGGTGACGAGGAGCAGCGTGGGCGGCTCATCTTTGCCGTCACCATTTCCACGCTTGGCCTCGCC
ACCATGCTCGTCGGCGCCCGCACCGTGAGCCGCTTCTTCATCGTCCGTAGGGTCACCTGGGACGACAAGGTCATG
ATCTTGGCCTGGTTTCTCGCCTCCGGCCTCTCATTCACCGTCAGCCTCGGCGCCTTCCACGGCCTGGGAAAATCC
GAGGCCGATATTTCGGATGAGAGCAAGCGCATCCTTCTCCGGTGCGAATACGTCTTCTCCATCTTATACAACCCG
GCCCTCATGGCCACCAAGACGGCCATCTTGATATTCTATCTCCACCTTGCAAACAACACCCAGCTGTTCCTGCGC
TATGCCTCATGGACCGTCCTGGCCATCAGCAACCTCGCCGGCTTCATCCTCACCGTCATCAACATCTTCCAGTGC
ACCCCGATCCAGGCGGCCTGGACTCTGTACACCTTCGACGAGACCGCCTCATGCATACCGCTCCTCACCGAGTTT
ATCTGCGTTACGCCTATTAATATTATCACAGACCTGGCCATTCTCGTCTTACCCATCCCGCTCCTCACCAATCTA
CGGCTGCCGATCCGGCAGAAGACGGTTCTCGTACTAGCCTTTGCCCTCGGCGTCTTCGTCACCGTCATCGGCGTC
ATCCGCATCTACTACCTGCAGTGCGCTATCCTGGACGACTCGCCGGAGGAAGACGGAGCGCCGATGCAGAATATT
ACGACGCTCGGCGGTCAGGCCGATTTCTCGAGGAGCGCCTCCTTCGCCTTGATGTGGAGCACAGTCGAGGTCAAC
ATCGGCATCGCCTGTGCCTGCATCCCGACTATCAAGCCGCTCATCGCCAAGCTGTTCCCCAGGTTACTGAACGAC
AGTCCCGGCAACCGGTCGCAGGCTTCCATCGACTCTCAGCTGACGCTGTGCCCGAGCCAGTCGACGTCGTCGAAC
CTGACGCCGTCGGCCAAGAAGGCGGCCACGATGAAGGAGAAGCAGCTGGAGGACGAGTTTGAGACGCCGCCGGCG
AGTCCCTGCGACAACACCCTCTTCGGCTTCGTCAACATGACCAAGCCGATCAACATGATCGATGCTAGCGTGGCA
GAGTCCTTCCGCTTCTGTGCCATGATCTCCTCCCTCTTCTTCCTCTGGGGCGTGTCGTACGGCCTGATCGATGCC
ATCAACCACGCCGTGGCCCTGGTCAGCAACATCACGACGGCCCAGTCCATCGGCCTGTCGGCCGCCTACTTTGGC
GGCGGCTACTTCTTCGGGCCCCTCTTCGCCACCCGGTTCCTCCTGCGGCGCGGGCGCGACGGCGTCCTGTCGTGC
GACGACGTGGGCGGCTACAAGCTGACCTTCATCACCGGCATCTGCATCTACGGCGTCGGCACCATCTCCTTCTGG
CCGTCGGCGGCCCTGTCGTCCTACCCCGGCTTCTTGCTCAGCAACCTCATCGCCGGCTTCGGCTTGGCCGTCCTC
GAGGTCGGCGCCAACGCCTACATCATCCTGTGTGGGCCGCCCGACTACGGCCAGTCGCGGCTCCTGGTGGCCCAG
GGGATCCAGGGGCTGGGCAGCGTCGTCAGCAGCCTGCTGGGGCAAAAGGTGCTGCTCACGGGCATCGTCGCCGGC
GACAGCAAGGCGCTCATCAACATCCAATGGGTCTACCTGGGCGCGACGCTCATGTGCGCCCTCATCGGCCTCTTG
TTCTACTACGCGCCCTTGCCCGAGGCCACCGACGATGAGCTCGACCAGCTGGCGGGCCGCCTCCAGGTCGACCCG
TGCAAGCACGTCATCGGCGGCCTGCAGCTGCGCACGGCGAGCCTCGTCCTGGCCGTCTTCACGCAGTACATGTAC
GTGGCGACGCAGGAGACCAACCACCTCTTCATGCGGCCCCTCCTCCTCTCCAGCTTCGGCGTCGACATCAGCCGG
GGGGAAAGCAATACGGACCAGCCGCCGGGCATGACGCTGACGATCCCCGACTACCTGCTGCTCGGACGCACGGCC
TTTACCATCTCCCGCCTCCTCTTCGGCTACCTGACCTATCTGTCGGCCTCGCGTCCCCGACTGCCCAGGCCGCAC
ACGTATCTCGCCATGTGCGTGGTCGCGAGCCTGGTCCTGTCCGTCGTCCGCGTCGTGGTCAACCCGTCGAACCCC
AACCTGCGCGTCATCCCTATCGTGCTGATGTTCTTCGTCGAGGCCCCCATGTGGCCGCTGCTGTTCGCGCTCGGC
CTGCGCGGGCAGGGGCGGAGGACGTCCACGGCGGCGGCGCTGCTCACGATGGGCGGCTCCGGGTCGGCGCTGATC
CCGTACGCCATGTACGCCATCGTCCAGGCCGGCGCCACGGTGCAGGCCGCCTACGTGGTCGTCGTTGCCGTGCAG
GCCACGCTCACATTGTACCCCGCCTTTCTCACGCTCAACCGGGACGCGAGACGACTGGCCGAGCCGTATTCCGCT
GCGCGGCATCCGAGGCGAACGAGCCGAGACGGCACCTGA
Gene >Hirsu2|887
ATGGCCGCCACCGGTGACGAGGAGCAGCGTGGGCGGCTCATCTTTGCCGTCACCATTTCCACGCTTGGCCTCGCC
ACCATGCTCGTCGGCGCCCGCACCGTGAGCCGCTTCTTCATCGTCCGTAGGGTCACCTGGGACGACAAGGTCATG
ATCTTGGCCTGGTTTCTCGCCTCCGGCCTCTCATTCACCGTCAGCCTCGGCGCCTTCCACGGCCTGGGAAAATCC
GAGGCCGATATTTCGGATGAGAGCAAGCGCATCCTTCTCCGGTGCGAATACGTCTTCTCCATCTTATACGTAAGT
CCAGTCCCCGTCTCGTCACGTCTCCCGACGGCATCTGATGCGCAAGCCTCGGCGGCAGAACCCGGCCCTCATGGC
CACCAAGACGGCCATCTTGATATTCTATCTCCACCTTGCAAACAACACCCAGCTGTTCCTGCGCTATGCCTCATG
GACCGTCCTGGCCATCAGCAACCTCGCCGGCTTCATCCTCACCGTCATCAACATCTTCCAGTGCACCCCGATCCA
GGCGGCCTGGACTCTGTACACCTTCGACGAGACCGCCTCATGCATACCGCTCCTCACCGAGTTTATCTGCGTTAC
GCCTATTAATATTATCACAGACCTGGCCATTCTCGTCTTACCCATCCCGCTCCTCACCAATCTACGGCTGCCGAT
CCGGCAGAAGACGGTTCTCGTACTAGCCTTTGCCCTCGGCGTCTTCGTCACCGTCATCGGCGTCATCCGCATCTA
CTACCTGCAGTGCGCTATCCTGGACGACTCGCCGGAGGAAGACGGAGCGCCGATGCAGAATATTACGACGCTCGG
CGGTCAGGCCGATTTCTCGAGGAGCGCCTCCTTCGCCTTGATGTGGAGCACAGTCGAGGTCAACATCGGCATCGC
CTGTGCCTGCATCCCGACTATCAAGCCGCTCATCGCCAAGCTGTTCCCCAGGTTACTGAACGACAGTCCCGGCAA
CCGGTCGCAGGCTTCCATCGACTCTCAGCTGACGCTGTGCCCGAGCCAGTCGACGTCGTCGAACCTGACGCCGTC
GGCCAAGAAGGCGGCCACGATGAAGGAGAAGCAGCTGGAGGACGAGTTTGAGACGCCGCCGGCGAGTCCCTGCGA
CAACACCCTCTTCGGCTTCGTCAACATGACCAAGCCGATCAACATGATCGATGCTAGCGTGGCAGAGTCCTTCCG
CTTCTGTGCCATGATCTCCTCCCTCTTCTTCCTCTGGGGCGTGTCGTACGGCCTGATCGATGCCATCAACCACGC
CGTGGCCCTGGTCAGCAACATCACGACGGCCCAGTCCATCGGCCTGTCGGCCGCCTACTTTGGCGGCGGCTACTT
CTTCGGGCCCCTCTTCGCCACCCGGTTCCTCCTGCGGCGCGGGCGCGACGGCGTCCTGTCGTGCGACGACGTGGG
CGGCTACAAGCTGACCTTCATCACCGGCATCTGCATCTACGGCGTCGGCACCATCTCCTTCTGGCCGTCGGCGGC
CCTGTCGTCCTACCCCGGCTTCTTGCTCAGCAACCTCATCGCCGGCTTCGGCTTGGCCGTCCTCGAGGTCGGCGC
CAACGCCTACATCATCCTGTGTGGGCCGCCCGACTACGGCCAGTCGCGGCTCCTGGTGGCCCAGGGGATCCAGGG
GCTGGGCAGCGTCGTCAGCAGCCTGCTGGGGCAAAAGGTGCTGCTCACGGGCATCGTCGCCGGCGACAGCAAGGC
GCTCATCAACATCCAATGGGTCTACCTGGGCGCGACGCTCATGTGCGCCCTCATCGGCCTCTTGTTCTACTACGC
GCCCTTGCCCGAGGCCACCGACGATGAGCTCGACCAGCTGGCGGGCCGCCTCCAGGTCGACCCGTGCAAGCACGT
CATCGGCGGCCTGCAGCTGCGCACGGCGAGCCTCGTCCTGGCCGTCTTCACGCAGTACATGTACGTGGCGACGCA
GGAGACCAACCACCTCTTCATGCGGCCCCTCCTCCTCTCCAGCTTCGGCGTCGACATCAGCCGGGGGGAAAGCAA
TACGGACCAGCCGCCGGGCATGACGCTGACGATCCCCGACTACCTGCTGCTCGGACGCACGGCCTTTACCATCTC
CCGCCTCCTCTTCGGCTACCTGACCTATCTGTCGGCCTCGCGTCCCCGACTGCCCAGGCCGCACACGTATCTCGC
CATGTGCGTGGTCGCGAGCCTGGTCCTGTCCGTCGTCCGCGTCGTGGTCAACCCGTCGAACCCCAACCTGCGCGT
CATCCCTATCGTGCTGATGTTCTTCGTCGAGGCCCCCATGTGGCCGCTGCTGTTCGCGCTCGGCCTGCGCGGGCA
GGGGCGGAGGACGTCCACGGCGGCGGCGCTGCTCACGATGGGCGGCTCCGGGTCGGCGCTGATCCCGTACGCCAT
GTACGCCATCGTCCAGGCCGGCGCCACGGTGCAGGCCGCCTACGTGGTCGTCGTTGCCGTGCAGGCCACGCTCAC
ATTGTACCCCGCCTTTCTCACGCTCAACCGGGACGCGAGACGACTGGCCGAGCCGTATTCCGCTGCGCGGCATCC
GAGGCGAACGAGCCGAGACGGCACCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail