Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8856
Gene name
LocationContig_603:5285..8270
Strand-
Gene length (bp)2985
Transcript length (bp)2985
Coding sequence length (bp)2985
Protein length (aa) 995

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 158 274 9.0E-09
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 149 299 1.0E-08
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 198 283 4.0E-07
sp|C0H5F4|RBP2B_PLAF7 Reticulocyte binding protein 2 homolog b OS=Plasmodium falciparum (isolate 3D7) GN=Rh2b PE=3 SV=1 185 473 3.0E-06
sp|C0H5F4|RBP2B_PLAF7 Reticulocyte binding protein 2 homolog b OS=Plasmodium falciparum (isolate 3D7) GN=Rh2b PE=3 SV=1 200 333 4.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 158 274 9.0E-09
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 149 299 1.0E-08
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 198 283 4.0E-07
sp|C0H5F4|RBP2B_PLAF7 Reticulocyte binding protein 2 homolog b OS=Plasmodium falciparum (isolate 3D7) GN=Rh2b PE=3 SV=1 185 473 3.0E-06
sp|C0H5F4|RBP2B_PLAF7 Reticulocyte binding protein 2 homolog b OS=Plasmodium falciparum (isolate 3D7) GN=Rh2b PE=3 SV=1 200 333 4.0E-06
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 210 288 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 604 626 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8856
MAGLPANDAPSLVDARECASAPQRFPDAACTDSFSRRDSRDGHGRELPLTNADTSRVLPASTPLRISVATPSSNT
ASSTKSSITPTTPVMPVLARQLPPPLTTPAPPQGNPGSSSVQDSQGSRGLDRAPPGGRVENSQGSQDPNQAPPRS
RAQKSPPKAQTSEQLQPSGASQISQSRTRNGRGQDQREQDQEGKQDNKTQDKDRKAQEIQSQELEKQKKELEKQN
EEKRRQDEEKRRQDEEKRRQDEEKRRQDEEKRRQDEAKQLQESKLKAKESNSKQPQESKSQPLDNNSGTPTNDQN
DQRNPGIDKDENSQRVSPNDGINQGSEPDNKKNDKSKDQGRNQRQPGGDDTGRDQPQDPPPQDQPVSRLTTTTAS
SSIISSSPASTSAAPPRPAPANPTQAPPPRPRPSPPSPPPQGAVPGSDEVDDSLRDNDSLPDEKPPTDKAENPST
DENATDRDEQGSQRTATNGKDTNGSSSTALTTPPKPSDILSDVPSPSVASPSVALPPQPRPDRPAMTPGSDSNPR
EGEGASSSPSAVVAEPVSSTETPSQTQPLGDTETDNDIAANPPQDSNTVGGGPKGPGNSGNDPELDSGPNQASGL
SKSTIAGISAGSFAVVLLLAVLFWFLRKSMAKRRENRIPSPFSRSSSQRRGGDTASGIGDNLGAEIRTEKPEPAL
TFLGIHPRSRATATNGPMVDENQGSSQFWEASAIPRDEPASYHSAPNVLTMKDRVMDWWSRRAEDRDFNTRVRGD
QGGLPDGTVGVRNMGVDTPPNNRPELGLNVDGFGSLDPFADINAMSDHPMYARQIVQDGSSNPFADPSAVPTPLY
GRHNPAYYTAVSRLGSHSRSQSASVRNSQYSAHPMMYRPNSAARDSLQSVESFADRRNKFRSDPFDLELDGVMPN
ASDVAQMPPLNGMSSIYSSHTRAGSLPSSHYTSGVSMSDWSIADVETGPAPGPTTSAAGARWYGGIAQHRSGDVR
RWPSDQKRQRTGGGVGQAL*
Coding >Hirsu2|8856
ATGGCCGGATTGCCCGCAAACGACGCTCCATCTCTGGTCGACGCCAGGGAATGCGCTTCAGCGCCACAGCGCTTC
CCCGATGCCGCCTGCACCGACTCGTTCTCAAGGCGTGATAGTCGAGACGGTCACGGGCGTGAATTACCTTTGACC
AATGCGGATACTTCTCGAGTTTTACCGGCTTCCACTCCGTTGAGAATCTCGGTTGCGACGCCATCAAGCAACACC
GCTTCATCCACGAAATCGTCTATCACCCCAACAACGCCCGTCATGCCGGTACTGGCTCGGCAGCTCCCCCCCCCA
CTTACCACGCCAGCACCCCCTCAAGGCAACCCAGGGTCTTCCAGTGTTCAAGATAGTCAAGGATCTCGGGGCCTA
GATCGAGCTCCCCCTGGAGGCCGTGTTGAAAATAGCCAAGGGTCTCAAGACCCCAACCAAGCTCCGCCCAGAAGC
CGAGCTCAAAAATCGCCCCCGAAGGCTCAAACCTCAGAGCAGCTGCAACCGTCAGGAGCAAGTCAAATTTCACAA
TCTAGAACTCGAAATGGACGGGGACAGGATCAGCGGGAACAGGATCAAGAGGGAAAGCAAGATAATAAGACGCAA
GATAAAGATAGGAAGGCGCAAGAGATTCAGTCACAGGAACTTGAAAAGCAGAAGAAAGAACTCGAAAAACAGAAT
GAAGAGAAGCGACGGCAGGATGAAGAGAAACGACGACAGGATGAAGAGAAGCGACGGCAGGATGAAGAGAAGCGA
CGACAGGATGAAGAGAAGCGACGACAGGATGAGGCCAAACAGCTCCAAGAATCGAAACTTAAAGCAAAAGAGAGC
AACAGCAAGCAACCTCAAGAAAGCAAAAGCCAGCCTCTAGATAATAATTCAGGCACACCTACCAATGACCAGAAC
GACCAACGCAATCCTGGGATCGACAAGGACGAGAACAGCCAACGCGTTTCTCCCAACGACGGGATAAATCAAGGC
AGTGAGCCCGACAACAAAAAGAACGACAAAAGCAAGGACCAAGGCAGAAATCAACGCCAACCAGGCGGAGATGAC
ACTGGTAGAGACCAACCCCAGGACCCCCCACCTCAAGACCAGCCCGTGTCTCGATTGACCACAACTACAGCTTCG
TCATCAATAATAAGCTCCTCGCCTGCAAGCACATCAGCCGCACCTCCTCGGCCCGCCCCTGCCAATCCCACCCAA
GCACCGCCGCCGCGGCCACGGCCGTCACCACCGTCACCACCACCACAAGGAGCAGTGCCAGGTTCTGACGAAGTT
GACGACTCGCTGAGAGATAATGATTCTCTACCGGATGAAAAGCCTCCGACGGACAAGGCTGAAAATCCATCAACG
GACGAAAATGCAACCGACAGGGATGAGCAGGGATCGCAGCGGACTGCTACCAATGGGAAGGACACGAATGGAAGC
TCCTCGACAGCATTGACTACTCCGCCTAAGCCGTCGGACATTCTGTCTGACGTGCCGTCGCCGTCCGTCGCGTCG
CCGTCCGTCGCACTGCCGCCCCAACCTCGACCCGACCGACCTGCCATGACTCCTGGCTCAGACTCGAACCCGCGA
GAAGGGGAGGGAGCCTCATCATCACCCAGCGCGGTTGTAGCAGAGCCGGTCAGCTCAACGGAGACTCCAAGCCAG
ACTCAGCCTCTTGGCGACACAGAAACGGATAACGACATTGCCGCTAATCCTCCTCAGGACAGCAATACGGTGGGA
GGGGGGCCGAAGGGACCCGGAAACTCTGGAAACGACCCAGAGCTCGATTCAGGCCCCAACCAAGCCTCTGGTCTC
TCAAAGTCGACAATTGCAGGTATTTCCGCTGGTTCTTTCGCAGTCGTGCTGTTACTTGCGGTGTTGTTCTGGTTC
TTGCGGAAGTCCATGGCAAAGCGCAGGGAAAATCGTATTCCATCGCCTTTCTCCAGATCCAGTTCTCAAAGACGA
GGAGGTGACACGGCTAGCGGCATAGGAGATAATTTGGGAGCCGAGATACGAACGGAAAAACCAGAGCCTGCCCTT
ACTTTCCTCGGTATACACCCGAGATCCCGAGCTACCGCCACCAACGGGCCGATGGTGGATGAAAACCAAGGATCC
TCGCAGTTCTGGGAGGCGTCTGCGATACCGCGAGACGAGCCAGCCTCATACCACTCAGCGCCCAACGTGCTCACA
ATGAAGGACCGCGTGATGGATTGGTGGTCCAGAAGAGCAGAAGATCGAGACTTCAATACCCGCGTCCGAGGCGAC
CAGGGAGGGCTACCGGACGGCACCGTGGGCGTGCGGAATATGGGTGTGGATACGCCCCCGAACAATCGACCTGAA
TTGGGACTTAATGTCGATGGCTTCGGAAGTCTGGATCCATTTGCCGACATCAACGCCATGTCTGACCATCCGATG
TACGCGAGGCAAATTGTGCAAGACGGGTCTTCGAACCCCTTTGCCGATCCCAGTGCCGTCCCAACTCCGCTCTAT
GGGCGGCACAACCCTGCGTACTACACCGCCGTAAGCCGGCTTGGATCTCACAGCCGTTCTCAGAGCGCCTCGGTG
CGCAACTCTCAGTATTCAGCCCATCCCATGATGTATCGCCCGAACTCGGCTGCACGGGATTCGCTTCAGAGTGTC
GAATCTTTCGCCGATCGACGCAACAAATTCCGATCCGATCCATTCGACCTTGAGCTTGATGGTGTCATGCCGAAC
GCCAGTGACGTTGCACAGATGCCCCCCCTCAATGGGATGAGTTCAATATACAGTTCGCACACCCGCGCAGGCAGC
CTGCCGTCCTCACACTACACAAGCGGCGTCAGTATGAGTGATTGGAGCATAGCCGACGTTGAAACAGGTCCGGCG
CCAGGGCCGACAACGTCGGCAGCTGGTGCGCGATGGTACGGGGGCATTGCTCAACATCGGTCAGGGGACGTGAGG
AGATGGCCGAGCGATCAGAAGCGTCAACGAACAGGTGGAGGCGTCGGCCAGGCATTGTGA
Transcript >Hirsu2|8856
ATGGCCGGATTGCCCGCAAACGACGCTCCATCTCTGGTCGACGCCAGGGAATGCGCTTCAGCGCCACAGCGCTTC
CCCGATGCCGCCTGCACCGACTCGTTCTCAAGGCGTGATAGTCGAGACGGTCACGGGCGTGAATTACCTTTGACC
AATGCGGATACTTCTCGAGTTTTACCGGCTTCCACTCCGTTGAGAATCTCGGTTGCGACGCCATCAAGCAACACC
GCTTCATCCACGAAATCGTCTATCACCCCAACAACGCCCGTCATGCCGGTACTGGCTCGGCAGCTCCCCCCCCCA
CTTACCACGCCAGCACCCCCTCAAGGCAACCCAGGGTCTTCCAGTGTTCAAGATAGTCAAGGATCTCGGGGCCTA
GATCGAGCTCCCCCTGGAGGCCGTGTTGAAAATAGCCAAGGGTCTCAAGACCCCAACCAAGCTCCGCCCAGAAGC
CGAGCTCAAAAATCGCCCCCGAAGGCTCAAACCTCAGAGCAGCTGCAACCGTCAGGAGCAAGTCAAATTTCACAA
TCTAGAACTCGAAATGGACGGGGACAGGATCAGCGGGAACAGGATCAAGAGGGAAAGCAAGATAATAAGACGCAA
GATAAAGATAGGAAGGCGCAAGAGATTCAGTCACAGGAACTTGAAAAGCAGAAGAAAGAACTCGAAAAACAGAAT
GAAGAGAAGCGACGGCAGGATGAAGAGAAACGACGACAGGATGAAGAGAAGCGACGGCAGGATGAAGAGAAGCGA
CGACAGGATGAAGAGAAGCGACGACAGGATGAGGCCAAACAGCTCCAAGAATCGAAACTTAAAGCAAAAGAGAGC
AACAGCAAGCAACCTCAAGAAAGCAAAAGCCAGCCTCTAGATAATAATTCAGGCACACCTACCAATGACCAGAAC
GACCAACGCAATCCTGGGATCGACAAGGACGAGAACAGCCAACGCGTTTCTCCCAACGACGGGATAAATCAAGGC
AGTGAGCCCGACAACAAAAAGAACGACAAAAGCAAGGACCAAGGCAGAAATCAACGCCAACCAGGCGGAGATGAC
ACTGGTAGAGACCAACCCCAGGACCCCCCACCTCAAGACCAGCCCGTGTCTCGATTGACCACAACTACAGCTTCG
TCATCAATAATAAGCTCCTCGCCTGCAAGCACATCAGCCGCACCTCCTCGGCCCGCCCCTGCCAATCCCACCCAA
GCACCGCCGCCGCGGCCACGGCCGTCACCACCGTCACCACCACCACAAGGAGCAGTGCCAGGTTCTGACGAAGTT
GACGACTCGCTGAGAGATAATGATTCTCTACCGGATGAAAAGCCTCCGACGGACAAGGCTGAAAATCCATCAACG
GACGAAAATGCAACCGACAGGGATGAGCAGGGATCGCAGCGGACTGCTACCAATGGGAAGGACACGAATGGAAGC
TCCTCGACAGCATTGACTACTCCGCCTAAGCCGTCGGACATTCTGTCTGACGTGCCGTCGCCGTCCGTCGCGTCG
CCGTCCGTCGCACTGCCGCCCCAACCTCGACCCGACCGACCTGCCATGACTCCTGGCTCAGACTCGAACCCGCGA
GAAGGGGAGGGAGCCTCATCATCACCCAGCGCGGTTGTAGCAGAGCCGGTCAGCTCAACGGAGACTCCAAGCCAG
ACTCAGCCTCTTGGCGACACAGAAACGGATAACGACATTGCCGCTAATCCTCCTCAGGACAGCAATACGGTGGGA
GGGGGGCCGAAGGGACCCGGAAACTCTGGAAACGACCCAGAGCTCGATTCAGGCCCCAACCAAGCCTCTGGTCTC
TCAAAGTCGACAATTGCAGGTATTTCCGCTGGTTCTTTCGCAGTCGTGCTGTTACTTGCGGTGTTGTTCTGGTTC
TTGCGGAAGTCCATGGCAAAGCGCAGGGAAAATCGTATTCCATCGCCTTTCTCCAGATCCAGTTCTCAAAGACGA
GGAGGTGACACGGCTAGCGGCATAGGAGATAATTTGGGAGCCGAGATACGAACGGAAAAACCAGAGCCTGCCCTT
ACTTTCCTCGGTATACACCCGAGATCCCGAGCTACCGCCACCAACGGGCCGATGGTGGATGAAAACCAAGGATCC
TCGCAGTTCTGGGAGGCGTCTGCGATACCGCGAGACGAGCCAGCCTCATACCACTCAGCGCCCAACGTGCTCACA
ATGAAGGACCGCGTGATGGATTGGTGGTCCAGAAGAGCAGAAGATCGAGACTTCAATACCCGCGTCCGAGGCGAC
CAGGGAGGGCTACCGGACGGCACCGTGGGCGTGCGGAATATGGGTGTGGATACGCCCCCGAACAATCGACCTGAA
TTGGGACTTAATGTCGATGGCTTCGGAAGTCTGGATCCATTTGCCGACATCAACGCCATGTCTGACCATCCGATG
TACGCGAGGCAAATTGTGCAAGACGGGTCTTCGAACCCCTTTGCCGATCCCAGTGCCGTCCCAACTCCGCTCTAT
GGGCGGCACAACCCTGCGTACTACACCGCCGTAAGCCGGCTTGGATCTCACAGCCGTTCTCAGAGCGCCTCGGTG
CGCAACTCTCAGTATTCAGCCCATCCCATGATGTATCGCCCGAACTCGGCTGCACGGGATTCGCTTCAGAGTGTC
GAATCTTTCGCCGATCGACGCAACAAATTCCGATCCGATCCATTCGACCTTGAGCTTGATGGTGTCATGCCGAAC
GCCAGTGACGTTGCACAGATGCCCCCCCTCAATGGGATGAGTTCAATATACAGTTCGCACACCCGCGCAGGCAGC
CTGCCGTCCTCACACTACACAAGCGGCGTCAGTATGAGTGATTGGAGCATAGCCGACGTTGAAACAGGTCCGGCG
CCAGGGCCGACAACGTCGGCAGCTGGTGCGCGATGGTACGGGGGCATTGCTCAACATCGGTCAGGGGACGTGAGG
AGATGGCCGAGCGATCAGAAGCGTCAACGAACAGGTGGAGGCGTCGGCCAGGCATTGTGA
Gene >Hirsu2|8856
ATGGCCGGATTGCCCGCAAACGACGCTCCATCTCTGGTCGACGCCAGGGAATGCGCTTCAGCGCCACAGCGCTTC
CCCGATGCCGCCTGCACCGACTCGTTCTCAAGGCGTGATAGTCGAGACGGTCACGGGCGTGAATTACCTTTGACC
AATGCGGATACTTCTCGAGTTTTACCGGCTTCCACTCCGTTGAGAATCTCGGTTGCGACGCCATCAAGCAACACC
GCTTCATCCACGAAATCGTCTATCACCCCAACAACGCCCGTCATGCCGGTACTGGCTCGGCAGCTCCCCCCCCCA
CTTACCACGCCAGCACCCCCTCAAGGCAACCCAGGGTCTTCCAGTGTTCAAGATAGTCAAGGATCTCGGGGCCTA
GATCGAGCTCCCCCTGGAGGCCGTGTTGAAAATAGCCAAGGGTCTCAAGACCCCAACCAAGCTCCGCCCAGAAGC
CGAGCTCAAAAATCGCCCCCGAAGGCTCAAACCTCAGAGCAGCTGCAACCGTCAGGAGCAAGTCAAATTTCACAA
TCTAGAACTCGAAATGGACGGGGACAGGATCAGCGGGAACAGGATCAAGAGGGAAAGCAAGATAATAAGACGCAA
GATAAAGATAGGAAGGCGCAAGAGATTCAGTCACAGGAACTTGAAAAGCAGAAGAAAGAACTCGAAAAACAGAAT
GAAGAGAAGCGACGGCAGGATGAAGAGAAACGACGACAGGATGAAGAGAAGCGACGGCAGGATGAAGAGAAGCGA
CGACAGGATGAAGAGAAGCGACGACAGGATGAGGCCAAACAGCTCCAAGAATCGAAACTTAAAGCAAAAGAGAGC
AACAGCAAGCAACCTCAAGAAAGCAAAAGCCAGCCTCTAGATAATAATTCAGGCACACCTACCAATGACCAGAAC
GACCAACGCAATCCTGGGATCGACAAGGACGAGAACAGCCAACGCGTTTCTCCCAACGACGGGATAAATCAAGGC
AGTGAGCCCGACAACAAAAAGAACGACAAAAGCAAGGACCAAGGCAGAAATCAACGCCAACCAGGCGGAGATGAC
ACTGGTAGAGACCAACCCCAGGACCCCCCACCTCAAGACCAGCCCGTGTCTCGATTGACCACAACTACAGCTTCG
TCATCAATAATAAGCTCCTCGCCTGCAAGCACATCAGCCGCACCTCCTCGGCCCGCCCCTGCCAATCCCACCCAA
GCACCGCCGCCGCGGCCACGGCCGTCACCACCGTCACCACCACCACAAGGAGCAGTGCCAGGTTCTGACGAAGTT
GACGACTCGCTGAGAGATAATGATTCTCTACCGGATGAAAAGCCTCCGACGGACAAGGCTGAAAATCCATCAACG
GACGAAAATGCAACCGACAGGGATGAGCAGGGATCGCAGCGGACTGCTACCAATGGGAAGGACACGAATGGAAGC
TCCTCGACAGCATTGACTACTCCGCCTAAGCCGTCGGACATTCTGTCTGACGTGCCGTCGCCGTCCGTCGCGTCG
CCGTCCGTCGCACTGCCGCCCCAACCTCGACCCGACCGACCTGCCATGACTCCTGGCTCAGACTCGAACCCGCGA
GAAGGGGAGGGAGCCTCATCATCACCCAGCGCGGTTGTAGCAGAGCCGGTCAGCTCAACGGAGACTCCAAGCCAG
ACTCAGCCTCTTGGCGACACAGAAACGGATAACGACATTGCCGCTAATCCTCCTCAGGACAGCAATACGGTGGGA
GGGGGGCCGAAGGGACCCGGAAACTCTGGAAACGACCCAGAGCTCGATTCAGGCCCCAACCAAGCCTCTGGTCTC
TCAAAGTCGACAATTGCAGGTATTTCCGCTGGTTCTTTCGCAGTCGTGCTGTTACTTGCGGTGTTGTTCTGGTTC
TTGCGGAAGTCCATGGCAAAGCGCAGGGAAAATCGTATTCCATCGCCTTTCTCCAGATCCAGTTCTCAAAGACGA
GGAGGTGACACGGCTAGCGGCATAGGAGATAATTTGGGAGCCGAGATACGAACGGAAAAACCAGAGCCTGCCCTT
ACTTTCCTCGGTATACACCCGAGATCCCGAGCTACCGCCACCAACGGGCCGATGGTGGATGAAAACCAAGGATCC
TCGCAGTTCTGGGAGGCGTCTGCGATACCGCGAGACGAGCCAGCCTCATACCACTCAGCGCCCAACGTGCTCACA
ATGAAGGACCGCGTGATGGATTGGTGGTCCAGAAGAGCAGAAGATCGAGACTTCAATACCCGCGTCCGAGGCGAC
CAGGGAGGGCTACCGGACGGCACCGTGGGCGTGCGGAATATGGGTGTGGATACGCCCCCGAACAATCGACCTGAA
TTGGGACTTAATGTCGATGGCTTCGGAAGTCTGGATCCATTTGCCGACATCAACGCCATGTCTGACCATCCGATG
TACGCGAGGCAAATTGTGCAAGACGGGTCTTCGAACCCCTTTGCCGATCCCAGTGCCGTCCCAACTCCGCTCTAT
GGGCGGCACAACCCTGCGTACTACACCGCCGTAAGCCGGCTTGGATCTCACAGCCGTTCTCAGAGCGCCTCGGTG
CGCAACTCTCAGTATTCAGCCCATCCCATGATGTATCGCCCGAACTCGGCTGCACGGGATTCGCTTCAGAGTGTC
GAATCTTTCGCCGATCGACGCAACAAATTCCGATCCGATCCATTCGACCTTGAGCTTGATGGTGTCATGCCGAAC
GCCAGTGACGTTGCACAGATGCCCCCCCTCAATGGGATGAGTTCAATATACAGTTCGCACACCCGCGCAGGCAGC
CTGCCGTCCTCACACTACACAAGCGGCGTCAGTATGAGTGATTGGAGCATAGCCGACGTTGAAACAGGTCCGGCG
CCAGGGCCGACAACGTCGGCAGCTGGTGCGCGATGGTACGGGGGCATTGCTCAACATCGGTCAGGGGACGTGAGG
AGATGGCCGAGCGATCAGAAGCGTCAACGAACAGGTGGAGGCGTCGGCCAGGCATTGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail