Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8848
Gene name
LocationContig_602:6620..7721
Strand+
Gene length (bp)1101
Transcript length (bp)855
Coding sequence length (bp)855
Protein length (aa) 285

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08445 FR47 FR47-like protein 8.7E-07 202 259
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 1.1E-06 174 257
PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain 5.3E-06 204 262

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P16966|TTR_PSEAJ Acetyltransferase OS=Pseudomonas amygdali pv. tabaci GN=ttr PE=1 SV=1 111 284 4.0E-14

GO

GO Term Description Terminal node
GO:0016747 transferase activity, transferring acyl groups other than amino-acyl groups Yes
GO:0016746 transferase activity, transferring acyl groups No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8848
MIQRSRPRRTEPASSRLATTTDDPPWPCRRATTTCSSEEPETGAGDGRLSNWLLSPSQTHVCLVALCMPSIIVAS
SPASPSKPRTRLWPDRPRDERIMSHAPPPGLVLPFSSKAHAHLTPYLAAIHASCITHDRAIATFLPPLSHEKLLS
WWKERIAEVNDGKRLIWILVSELDASARPRGPEVMGVVMLAMPYSETGPFRGLVEKLLVHKSFRGRGGARALMGA
LESDAAKLGRTVLLLDTETDSPAEAVCKKLGYIEMGRIPRYGMSPSGELKDGTFLYKHL*
Coding >Hirsu2|8848
ATGATCCAACGCTCTCGACCGAGGCGGACGGAGCCGGCGAGCTCCCGCCTGGCCACGACGACGGACGACCCGCCT
TGGCCTTGTCGCCGCGCCACTACGACCTGCTCCTCCGAAGAGCCGGAGACCGGAGCTGGCGACGGACGGCTGTCG
AATTGGCTTCTGTCGCCCTCGCAAACGCACGTCTGCCTCGTCGCGCTCTGCATGCCGTCCATCATTGTCGCATCG
TCGCCCGCTTCTCCCTCCAAGCCCCGAACTCGACTGTGGCCCGACCGGCCCAGAGACGAGCGCATCATGTCCCAC
GCCCCTCCTCCCGGCCTGGTCCTCCCCTTCAGCTCCAAGGCCCATGCCCACCTGACGCCCTACCTGGCCGCCATC
CACGCCTCCTGCATCACCCACGACCGCGCCATCGCCACCTTCCTGCCGCCCCTGTCGCACGAGAAGCTGCTGTCG
TGGTGGAAAGAGCGCATCGCCGAGGTCAATGACGGCAAGCGGCTGATCTGGATTCTGGTGAGCGAGCTGGACGCC
TCGGCCAGGCCCAGGGGTCCCGAGGTCATGGGCGTCGTCATGCTGGCCATGCCCTACTCCGAGACGGGGCCCTTC
CGCGGCCTCGTCGAGAAGCTGCTGGTCCACAAGAGCTTCCGCGGCAGGGGCGGTGCCAGGGCCCTCATGGGCGCC
CTCGAGAGCGACGCGGCCAAGCTGGGACGCACCGTGCTGCTGCTCGATACCGAGACGGACAGCCCTGCCGAGGCC
GTCTGCAAGAAGCTAGGCTACATCGAGATGGGCAGGATTCCGAGATACGGCATGAGCCCGTCCGGCGAGCTGAAG
GACGGCACCTTTCTCTACAAGCACCTCTAG
Transcript >Hirsu2|8848
ATGATCCAACGCTCTCGACCGAGGCGGACGGAGCCGGCGAGCTCCCGCCTGGCCACGACGACGGACGACCCGCCT
TGGCCTTGTCGCCGCGCCACTACGACCTGCTCCTCCGAAGAGCCGGAGACCGGAGCTGGCGACGGACGGCTGTCG
AATTGGCTTCTGTCGCCCTCGCAAACGCACGTCTGCCTCGTCGCGCTCTGCATGCCGTCCATCATTGTCGCATCG
TCGCCCGCTTCTCCCTCCAAGCCCCGAACTCGACTGTGGCCCGACCGGCCCAGAGACGAGCGCATCATGTCCCAC
GCCCCTCCTCCCGGCCTGGTCCTCCCCTTCAGCTCCAAGGCCCATGCCCACCTGACGCCCTACCTGGCCGCCATC
CACGCCTCCTGCATCACCCACGACCGCGCCATCGCCACCTTCCTGCCGCCCCTGTCGCACGAGAAGCTGCTGTCG
TGGTGGAAAGAGCGCATCGCCGAGGTCAATGACGGCAAGCGGCTGATCTGGATTCTGGTGAGCGAGCTGGACGCC
TCGGCCAGGCCCAGGGGTCCCGAGGTCATGGGCGTCGTCATGCTGGCCATGCCCTACTCCGAGACGGGGCCCTTC
CGCGGCCTCGTCGAGAAGCTGCTGGTCCACAAGAGCTTCCGCGGCAGGGGCGGTGCCAGGGCCCTCATGGGCGCC
CTCGAGAGCGACGCGGCCAAGCTGGGACGCACCGTGCTGCTGCTCGATACCGAGACGGACAGCCCTGCCGAGGCC
GTCTGCAAGAAGCTAGGCTACATCGAGATGGGCAGGATTCCGAGATACGGCATGAGCCCGTCCGGCGAGCTGAAG
GACGGCACCTTTCTCTACAAGCACCTCTAG
Gene >Hirsu2|8848
ATGATCCAACGCTCTCGACCGAGGCGGACGGAGCCGGCGAGCTCCCGCCTGGCCACGACGGTCAGAGAGCCGGAG
CGTGCAGGCTTGGGACCCCGTCAGCTCCTCTTCGTGCCGCCCTGAAGCGCTCGGCCATCGTCTGGACAAAGGCCC
CCTCTCCCTCTTCGTCCTTCTTCCTCCTCGCAACCTCTGCAGACGGACGACCCGCCTTGGCCTTGTCGCCGCGCC
ACTACGACCTGCTCCTCCGAAGAGCCGGAGACCGGAGCTGGCGACGGACGGCTGTAAGTTGCCGCCGACGTGTGA
CGTCGCCTGCTAACCCGTGCCAAGGTCGAATTGGCTTCTGTCGCCCTCGCAAACGCACGTCTGCCTCGTCGCGCT
CTGCATGCCGTCCATCATTGTCGCATCGTCGCCCGCTTCTCCCTCCAAGCCCCGAACTCGACTGTGGCCCGACCG
GCCCAGAGACGAGCGCATCATGTCCCACGCCCCTCCTCCCGGCCTGGTCCTCCCCTTCAGCTCCAAGGCCCATGC
CCACCTGACGCCCTACCTGGCCGCCATCCACGCCTCCTGCATCACCCACGACCGCGCCATCGCCACCTTCCTGCC
GCCCCTGTCGCACGAGAAGCTGCTGTCGTGGTGGAAAGAGCGCATCGCCGAGGTCAATGACGGCAAGCGGCTGAT
CTGGATTCTGGTGAGCGAGCTGGACGCCTCGGCCAGGCCCAGGGGTCCCGAGGTCATGGGCGTCGTCATGCTGGC
CATGCCCTACTCCGAGACGGGGCCCTTCCGCGGCCTCGTCGAGAAGCTGCTGGTCCACAAGAGCTTCCGCGGCAG
GGGCGGTGCCAGGGCCCTCATGGGCGCCCTCGAGAGCGACGCGGCCAAGCTGGGACGCACCGTGCTGGTACCTCG
TCTCCCTTGCCCGAACCCTGCCTTGCCTCTGAACGGCCGGTCTGACCTTGGACAACGCAGCTGCTCGATACCGAG
ACGGACAGCCCTGCCGAGGCCGTCTGCAAGAAGCTAGGCTACATCGAGATGGGCAGGATTCCGAGATACGGCATG
AGCCCGTCCGGCGAGCTGAAGGACGGCACCTTTCTCTACAAGCACCTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail