Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8846
Gene name
LocationContig_602:207..1637
Strand+
Gene length (bp)1430
Transcript length (bp)1353
Coding sequence length (bp)1353
Protein length (aa) 451

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 5.6E-19 4 91

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87178|YB1D_SCHPO Uncharacterized protein C3D6.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3D6.13c PE=1 SV=1 9 392 1.0E-66
sp|Q9P4X1|YKV5_SCHPO Thioredoxin domain-containing protein C959.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC959.05c PE=3 SV=4 18 370 5.0E-37
sp|O74481|YQJ8_SCHPO Uncharacterized protein C1840.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.08c PE=3 SV=1 25 348 2.0E-28
sp|Q4N4N8|TXND_THEPA Thioredoxin domain-containing protein OS=Theileria parva GN=TP02_0602 PE=1 SV=1 5 158 9.0E-17
sp|P21195|PDIA1_RABIT Protein disulfide-isomerase OS=Oryctolagus cuniculus GN=P4HB PE=2 SV=1 10 247 2.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87178|YB1D_SCHPO Uncharacterized protein C3D6.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3D6.13c PE=1 SV=1 9 392 1.0E-66
sp|Q9P4X1|YKV5_SCHPO Thioredoxin domain-containing protein C959.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC959.05c PE=3 SV=4 18 370 5.0E-37
sp|O74481|YQJ8_SCHPO Uncharacterized protein C1840.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.08c PE=3 SV=1 25 348 2.0E-28
sp|Q4N4N8|TXND_THEPA Thioredoxin domain-containing protein OS=Theileria parva GN=TP02_0602 PE=1 SV=1 5 158 9.0E-17
sp|P21195|PDIA1_RABIT Protein disulfide-isomerase OS=Oryctolagus cuniculus GN=P4HB PE=2 SV=1 10 247 2.0E-16
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 5 176 3.0E-16
sp|P05307|PDIA1_BOVIN Protein disulfide-isomerase OS=Bos taurus GN=P4HB PE=1 SV=1 10 250 6.0E-16
sp|Q5R5B6|PDIA1_PONAB Protein disulfide-isomerase OS=Pongo abelii GN=P4HB PE=2 SV=1 10 250 6.0E-16
sp|P07237|PDIA1_HUMAN Protein disulfide-isomerase OS=Homo sapiens GN=P4HB PE=1 SV=3 10 250 9.0E-16
sp|P09102|PDIA1_CHICK Protein disulfide-isomerase OS=Gallus gallus GN=P4HB PE=1 SV=3 10 250 1.0E-15
sp|Q2HWU2|PDIA1_MACFU Protein disulfide-isomerase OS=Macaca fuscata fuscata GN=P4HB PE=2 SV=1 10 250 1.0E-15
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 10 176 2.0E-15
sp|Q8GYD1|PDI51_ARATH Protein disulfide-isomerase 5-1 OS=Arabidopsis thaliana GN=PDIL5-1 PE=2 SV=1 9 116 4.0E-15
sp|Q67UF5|PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica GN=PDIL2-3 PE=2 SV=1 1 104 2.0E-14
sp|P04785|PDIA1_RAT Protein disulfide-isomerase OS=Rattus norvegicus GN=P4hb PE=1 SV=2 10 247 2.0E-14
sp|P09103|PDIA1_MOUSE Protein disulfide-isomerase OS=Mus musculus GN=P4hb PE=1 SV=2 10 247 3.0E-14
sp|Q869Z0|Y5025_DICDI Putative protein disulfide-isomerase DDB_G0275025 OS=Dictyostelium discoideum GN=DDB_G0275025 PE=1 SV=1 2 171 3.0E-14
sp|Q12730|PDI_ASPNG Protein disulfide-isomerase OS=Aspergillus niger GN=pdiA PE=2 SV=1 12 211 4.0E-14
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 10 84 5.0E-14
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 10 84 7.0E-14
sp|Q8R4U2|PDIA1_CRIGR Protein disulfide-isomerase OS=Cricetulus griseus GN=P4HB PE=2 SV=1 10 247 1.0E-13
sp|Q10N04|PDI51_ORYSJ Protein disulfide isomerase-like 5-1 OS=Oryza sativa subsp. japonica GN=PDIL5-1 PE=2 SV=1 9 94 1.0E-13
sp|O48773|PDI23_ARATH Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana GN=PDIL2-3 PE=2 SV=1 1 104 2.0E-13
sp|P55059|PDI_HUMIN Protein disulfide-isomerase OS=Humicola insolens PE=1 SV=1 4 228 2.0E-13
sp|Q9MAU6|PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana GN=PDIL2-2 PE=2 SV=2 1 104 2.0E-13
sp|Q00248|PDI_ASPOR Protein disulfide-isomerase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pdiA PE=3 SV=1 4 211 3.0E-13
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 9 111 4.0E-13
sp|D4B2L8|PDI_ARTBC Protein disulfide-isomerase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02626 PE=3 SV=1 4 228 4.0E-13
sp|Q10057|PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.02 PE=3 SV=1 11 124 6.0E-13
sp|Q17770|PDI2_CAEEL Protein disulfide-isomerase 2 OS=Caenorhabditis elegans GN=pdi-2 PE=1 SV=1 10 250 7.0E-13
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 6 236 1.0E-12
sp|Q54EN4|PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 6 210 1.0E-12
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 6 242 1.0E-12
sp|Q96JJ7|TMX3_HUMAN Protein disulfide-isomerase TMX3 OS=Homo sapiens GN=TMX3 PE=1 SV=2 3 122 1.0E-12
sp|Q50KB1|SEP2_EMIHU Protein disulfide-isomerase-like protein EhSep2 OS=Emiliania huxleyi GN=SEP2 PE=1 SV=2 1 111 2.0E-12
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 6 248 2.0E-12
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 6 228 3.0E-12
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 10 124 3.0E-12
sp|Q17967|PDI1_CAEEL Protein disulfide-isomerase 1 OS=Caenorhabditis elegans GN=pdi-1 PE=3 SV=1 10 125 3.0E-12
sp|P12244|GSBP_CHICK Dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Gallus gallus PE=2 SV=2 11 248 5.0E-12
sp|Q5R875|TMX3_PONAB Protein disulfide-isomerase TMX3 OS=Pongo abelii GN=TMX3 PE=2 SV=1 3 133 5.0E-12
sp|Q8BXZ1|TMX3_MOUSE Protein disulfide-isomerase TMX3 OS=Mus musculus GN=Tmx3 PE=1 SV=2 3 122 6.0E-12
sp|Q9MAU6|PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana GN=PDIL2-2 PE=2 SV=2 10 95 7.0E-12
sp|P12865|BS2_TRYBB Bloodstream-specific protein 2 OS=Trypanosoma brucei brucei GN=BS2 PE=3 SV=1 9 213 1.0E-11
sp|O08841|QSOX1_CAVPO Sulfhydryl oxidase 1 OS=Cavia porcellus GN=QSOX1 PE=2 SV=2 2 89 1.0E-11
sp|H2N4I1|QSOX1_PONAB Sulfhydryl oxidase 1 OS=Pongo abelii GN=QSOX1 PE=3 SV=2 2 72 1.0E-11
sp|Q5RCH2|PDIA2_PONAB Protein disulfide-isomerase A2 OS=Pongo abelii GN=PDIA2 PE=2 SV=1 1 230 2.0E-11
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 9 91 2.0E-11
sp|Q4VIT4|PDIA3_CHLAE Protein disulfide-isomerase A3 OS=Chlorocebus aethiops GN=PDIA3 PE=2 SV=1 10 125 2.0E-11
sp|Q6GNG3|TMX3_XENLA Protein disulfide-isomerase TMX3 OS=Xenopus laevis GN=tmx3 PE=2 SV=1 3 133 2.0E-11
sp|Q5RDG4|PDIA3_PONAB Protein disulfide-isomerase A3 OS=Pongo abelii GN=PDIA3 PE=2 SV=1 10 127 2.0E-11
sp|P30101|PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens GN=PDIA3 PE=1 SV=4 10 127 2.0E-11
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 9 109 3.0E-11
sp|Q6IUU3|QSOX1_RAT Sulfhydryl oxidase 1 OS=Rattus norvegicus GN=Qsox1 PE=1 SV=1 2 89 4.0E-11
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 9 83 6.0E-11
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 1 78 6.0E-11
sp|P54399|PDI_DROME Protein disulfide-isomerase OS=Drosophila melanogaster GN=Pdi PE=2 SV=1 10 114 6.0E-11
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 1 78 6.0E-11
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 2 213 6.0E-11
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 9 83 8.0E-11
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 9 91 9.0E-11
sp|Q8BND5|QSOX1_MOUSE Sulfhydryl oxidase 1 OS=Mus musculus GN=Qsox1 PE=1 SV=1 2 89 9.0E-11
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 9 91 1.0E-10
sp|Q12404|MPD1_YEAST Protein disulfide-isomerase MPD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPD1 PE=1 SV=1 10 71 1.0E-10
sp|P38657|PDIA3_BOVIN Protein disulfide-isomerase A3 OS=Bos taurus GN=PDIA3 PE=2 SV=1 10 124 1.0E-10
sp|P27773|PDIA3_MOUSE Protein disulfide-isomerase A3 OS=Mus musculus GN=Pdia3 PE=1 SV=2 10 124 1.0E-10
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 10 118 1.0E-10
sp|O00391|QSOX1_HUMAN Sulfhydryl oxidase 1 OS=Homo sapiens GN=QSOX1 PE=1 SV=3 2 72 2.0E-10
sp|P11598|PDIA3_RAT Protein disulfide-isomerase A3 OS=Rattus norvegicus GN=Pdia3 PE=1 SV=2 10 124 2.0E-10
sp|Q13087|PDIA2_HUMAN Protein disulfide-isomerase A2 OS=Homo sapiens GN=PDIA2 PE=1 SV=2 1 230 2.0E-10
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 10 231 2.0E-10
sp|Q67UF5|PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica GN=PDIL2-3 PE=2 SV=1 10 91 3.0E-10
sp|O48773|PDI23_ARATH Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana GN=PDIL2-3 PE=2 SV=1 10 95 3.0E-10
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 2 80 3.0E-10
sp|D3Z6P0|PDIA2_MOUSE Protein disulfide-isomerase A2 OS=Mus musculus GN=Pdia2 PE=1 SV=1 10 108 4.0E-10
sp|Q10057|PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.02 PE=3 SV=1 10 93 6.0E-10
sp|Q92249|ERP38_NEUCR Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 1 93 7.0E-10
sp|P38658|ERP60_SCHMA Probable protein disulfide-isomerase ER-60 OS=Schistosoma mansoni PE=3 SV=1 10 259 8.0E-10
sp|Q8JG64|PDIA3_CHICK Protein disulfide-isomerase A3 OS=Gallus gallus GN=PDIA3 PE=2 SV=1 10 128 9.0E-10
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 2 114 9.0E-10
sp|P07591|TRXM_SPIOL Thioredoxin M-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2 1 77 1.0E-09
sp|Q0E0I1|PDI53_ORYSJ Protein disulfide isomerase-like 5-3 OS=Oryza sativa subsp. japonica GN=PDIL5-3 PE=3 SV=1 10 248 1.0E-09
sp|Q41864|TRXM_MAIZE Thioredoxin M-type, chloroplastic OS=Zea mays GN=TRM1 PE=2 SV=1 1 77 1.0E-09
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 10 90 1.0E-09
sp|O13704|YEU5_SCHPO Thioredoxin domain-containing protein C13F5.05, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13F5.05 PE=3 SV=2 4 67 1.0E-09
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 10 114 1.0E-09
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 2 114 1.0E-09
sp|Q92249|ERP38_NEUCR Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 10 90 2.0E-09
sp|O22263|PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana GN=PDIL2-1 PE=2 SV=1 10 93 2.0E-09
sp|O22263|PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana GN=PDIL2-1 PE=2 SV=1 10 90 2.0E-09
sp|Q7M1B9|THIO_CHLAA Thioredoxin OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=trxA PE=1 SV=3 2 98 2.0E-09
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 4 85 2.0E-09
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 2 70 3.0E-09
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 2 76 3.0E-09
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 10 90 3.0E-09
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 10 90 3.0E-09
sp|Q9T042|PDI54_ARATH Protein disulfide-isomerase 5-4 OS=Arabidopsis thaliana GN=PDIL5-4 PE=2 SV=1 11 74 3.0E-09
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 10 238 4.0E-09
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 10 90 4.0E-09
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 10 89 4.0E-09
sp|Q5R6T1|PDIA6_PONAB Protein disulfide-isomerase A6 OS=Pongo abelii GN=PDIA6 PE=2 SV=1 2 99 4.0E-09
sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens GN=PDIA6 PE=1 SV=1 2 99 4.0E-09
sp|Q5RCH2|PDIA2_PONAB Protein disulfide-isomerase A2 OS=Pongo abelii GN=PDIA2 PE=2 SV=1 10 102 5.0E-09
sp|Q11067|PDIA6_CAEEL Probable protein disulfide-isomerase A6 OS=Caenorhabditis elegans GN=tag-320 PE=3 SV=1 1 123 5.0E-09
sp|P38661|PDIA6_MEDSA Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 10 90 6.0E-09
sp|Q9FF55|PDI14_ARATH Protein disulfide isomerase-like 1-4 OS=Arabidopsis thaliana GN=PDIL1-4 PE=1 SV=1 10 95 6.0E-09
sp|P48384|TRXM_PEA Thioredoxin M-type, chloroplastic OS=Pisum sativum PE=2 SV=1 1 75 7.0E-09
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 6 124 8.0E-09
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 6 124 9.0E-09
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 6 124 1.0E-08
sp|P38660|PDIA6_MESAU Protein disulfide-isomerase A6 OS=Mesocricetus auratus GN=PDIA6 PE=1 SV=1 2 99 1.0E-08
sp|Q63081|PDIA6_RAT Protein disulfide-isomerase A6 OS=Rattus norvegicus GN=Pdia6 PE=1 SV=2 2 95 1.0E-08
sp|Q63081|PDIA6_RAT Protein disulfide-isomerase A6 OS=Rattus norvegicus GN=Pdia6 PE=1 SV=2 2 99 1.0E-08
sp|Q0JD42|PDI52_ORYSJ Protein disulfide isomerase-like 5-2 OS=Oryza sativa subsp. japonica GN=PDIL5-2 PE=2 SV=2 7 248 1.0E-08
sp|Q922R8|PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus GN=Pdia6 PE=1 SV=3 2 99 1.0E-08
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 6 124 2.0E-08
sp|Q11067|PDIA6_CAEEL Probable protein disulfide-isomerase A6 OS=Caenorhabditis elegans GN=tag-320 PE=3 SV=1 2 83 2.0E-08
sp|P38661|PDIA6_MEDSA Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 10 89 2.0E-08
sp|Q922R8|PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus GN=Pdia6 PE=1 SV=3 2 95 2.0E-08
sp|P33791|THIO_STRAU Thioredoxin (Fragment) OS=Streptomyces aureofaciens GN=trxA PE=3 SV=1 2 76 2.0E-08
sp|Q17770|PDI2_CAEEL Protein disulfide-isomerase 2 OS=Caenorhabditis elegans GN=pdi-2 PE=1 SV=1 10 92 2.0E-08
sp|Q17967|PDI1_CAEEL Protein disulfide-isomerase 1 OS=Caenorhabditis elegans GN=pdi-1 PE=3 SV=1 10 99 2.0E-08
sp|D3Z6P0|PDIA2_MOUSE Protein disulfide-isomerase A2 OS=Mus musculus GN=Pdia2 PE=1 SV=1 1 230 3.0E-08
sp|P0A4L2|THIO1_NOSSO Thioredoxin-1 OS=Nostoc sp. (strain ATCC 29151 / PCC 7119) GN=trxA PE=1 SV=2 8 77 3.0E-08
sp|P0A4L1|THIO1_NOSS1 Thioredoxin-1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trxA PE=3 SV=2 8 77 3.0E-08
sp|P04785|PDIA1_RAT Protein disulfide-isomerase OS=Rattus norvegicus GN=P4hb PE=1 SV=2 10 117 3.0E-08
sp|P09103|PDIA1_MOUSE Protein disulfide-isomerase OS=Mus musculus GN=P4hb PE=1 SV=2 10 117 3.0E-08
sp|O13811|PDI2_SCHPO Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.14c PE=3 SV=1 10 125 4.0E-08
sp|Q6ZRP7|QSOX2_HUMAN Sulfhydryl oxidase 2 OS=Homo sapiens GN=QSOX2 PE=1 SV=3 9 80 4.0E-08
sp|Q54EN4|PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 1 99 4.0E-08
sp|P12244|GSBP_CHICK Dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Gallus gallus PE=2 SV=2 10 92 4.0E-08
sp|P38660|PDIA6_MESAU Protein disulfide-isomerase A6 OS=Mesocricetus auratus GN=PDIA6 PE=1 SV=1 2 95 5.0E-08
sp|P00275|THIO1_CORNE Thioredoxin C-1 OS=Corynebacterium nephridii PE=1 SV=1 2 76 6.0E-08
sp|Q9ZP20|TRXM5_ORYSJ Thioredoxin M5, chloroplastic OS=Oryza sativa subsp. japonica GN=TRXM PE=2 SV=1 1 77 6.0E-08
sp|Q8R4U2|PDIA1_CRIGR Protein disulfide-isomerase OS=Cricetulus griseus GN=P4HB PE=2 SV=1 10 92 6.0E-08
sp|D4B2L8|PDI_ARTBC Protein disulfide-isomerase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02626 PE=3 SV=1 10 114 6.0E-08
sp|Q9XF61|PDI_DATGL Protein disulfide-isomerase OS=Datisca glomerata GN=PDI PE=2 SV=1 1 99 7.0E-08
sp|P07237|PDIA1_HUMAN Protein disulfide-isomerase OS=Homo sapiens GN=P4HB PE=1 SV=3 10 92 7.0E-08
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 2 70 8.0E-08
sp|Q13087|PDIA2_HUMAN Protein disulfide-isomerase A2 OS=Homo sapiens GN=PDIA2 PE=1 SV=2 10 90 8.0E-08
sp|Q5R6T1|PDIA6_PONAB Protein disulfide-isomerase A6 OS=Pongo abelii GN=PDIA6 PE=2 SV=1 2 70 8.0E-08
sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens GN=PDIA6 PE=1 SV=1 2 70 8.0E-08
sp|Q69SA9|PDI54_ORYSJ Protein disulfide isomerase-like 5-4 OS=Oryza sativa subsp. japonica GN=PDIL5-4 PE=2 SV=1 11 80 8.0E-08
sp|P05307|PDIA1_BOVIN Protein disulfide-isomerase OS=Bos taurus GN=P4HB PE=1 SV=1 10 92 8.0E-08
sp|Q5R5B6|PDIA1_PONAB Protein disulfide-isomerase OS=Pongo abelii GN=P4HB PE=2 SV=1 10 92 8.0E-08
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 2 121 8.0E-08
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 4 92 9.0E-08
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 1 84 1.0E-07
sp|Q9ZP21|TRXM_WHEAT Thioredoxin M-type, chloroplastic OS=Triticum aestivum PE=2 SV=1 1 77 1.0E-07
sp|P52588|PDI_MAIZE Protein disulfide-isomerase OS=Zea mays GN=PDI PE=2 SV=1 11 99 1.0E-07
sp|P09102|PDIA1_CHICK Protein disulfide-isomerase OS=Gallus gallus GN=P4HB PE=1 SV=3 10 92 1.0E-07
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 2 77 2.0E-07
sp|Q9XF61|PDI_DATGL Protein disulfide-isomerase OS=Datisca glomerata GN=PDI PE=2 SV=1 11 160 2.0E-07
sp|Q8KEA4|THIO1_CHLTE Thioredoxin-1 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=trx1 PE=3 SV=1 1 74 2.0E-07
sp|P17967|PDI_YEAST Protein disulfide-isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDI1 PE=1 SV=2 4 101 2.0E-07
sp|P80284|PDI_HORVU Protein disulfide-isomerase OS=Hordeum vulgare GN=PDI PE=1 SV=2 6 99 2.0E-07
sp|Q8VX13|PDI13_ARATH Protein disulfide isomerase-like 1-3 OS=Arabidopsis thaliana GN=PDIL1-3 PE=2 SV=1 11 171 2.0E-07
sp|Q53LQ0|PDI11_ORYSJ Protein disulfide isomerase-like 1-1 OS=Oryza sativa subsp. japonica GN=PDIL1-1 PE=2 SV=1 11 99 2.0E-07
sp|Q2HWU2|PDIA1_MACFU Protein disulfide-isomerase OS=Macaca fuscata fuscata GN=P4HB PE=2 SV=1 10 92 2.0E-07
sp|Q00248|PDI_ASPOR Protein disulfide-isomerase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pdiA PE=3 SV=1 1 90 2.0E-07
sp|P52231|THIO_SYNY3 Thioredoxin OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trxA PE=1 SV=3 2 77 3.0E-07
sp|P29828|PDI_MEDSA Protein disulfide-isomerase OS=Medicago sativa GN=PDI PE=2 SV=1 10 117 3.0E-07
sp|Q43116|PDI_RICCO Protein disulfide-isomerase OS=Ricinus communis PE=2 SV=1 10 99 3.0E-07
sp|P52589|PDI_WHEAT Protein disulfide-isomerase OS=Triticum aestivum GN=PDI PE=2 SV=1 10 99 3.0E-07
sp|P17967|PDI_YEAST Protein disulfide-isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDI1 PE=1 SV=2 1 89 4.0E-07
sp|Q921X9|PDIA5_MOUSE Protein disulfide-isomerase A5 OS=Mus musculus GN=Pdia5 PE=1 SV=1 1 200 4.0E-07
sp|Q67IX6|PDI14_ORYSJ Protein disulfide isomerase-like 1-4 OS=Oryza sativa subsp. japonica GN=PDIL1-4 PE=2 SV=1 11 222 4.0E-07
sp|P21195|PDIA1_RABIT Protein disulfide-isomerase OS=Oryctolagus cuniculus GN=P4HB PE=2 SV=1 10 103 4.0E-07
sp|P29828|PDI_MEDSA Protein disulfide-isomerase OS=Medicago sativa GN=PDI PE=2 SV=1 2 99 5.0E-07
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 10 93 5.0E-07
sp|Q9SEU6|TRXM4_ARATH Thioredoxin M4, chloroplastic OS=Arabidopsis thaliana GN=At3g15360 PE=2 SV=2 8 75 6.0E-07
sp|Q4VIT4|PDIA3_CHLAE Protein disulfide-isomerase A3 OS=Chlorocebus aethiops GN=PDIA3 PE=2 SV=1 1 93 7.0E-07
sp|P80284|PDI_HORVU Protein disulfide-isomerase OS=Hordeum vulgare GN=PDI PE=1 SV=2 1 98 7.0E-07
sp|P0AA30|THIO_SHIFL Thioredoxin-1 OS=Shigella flexneri GN=trxA PE=3 SV=2 10 76 7.0E-07
sp|P0AA28|THIO_SALTY Thioredoxin-1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=trxA PE=3 SV=2 10 76 7.0E-07
sp|P0AA29|THIO_SALTI Thioredoxin-1 OS=Salmonella typhi GN=trxA PE=3 SV=2 10 76 7.0E-07
sp|P0AA25|THIO_ECOLI Thioredoxin-1 OS=Escherichia coli (strain K12) GN=trxA PE=1 SV=2 10 76 7.0E-07
sp|P0AA26|THIO_ECOL6 Thioredoxin-1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=trxA PE=3 SV=2 10 76 7.0E-07
sp|P0AA27|THIO_ECO57 Thioredoxin-1 OS=Escherichia coli O157:H7 GN=trxA PE=1 SV=2 10 76 7.0E-07
sp|Q5RDG4|PDIA3_PONAB Protein disulfide-isomerase A3 OS=Pongo abelii GN=PDIA3 PE=2 SV=1 1 93 7.0E-07
sp|P30101|PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens GN=PDIA3 PE=1 SV=4 1 93 7.0E-07
sp|P38657|PDIA3_BOVIN Protein disulfide-isomerase A3 OS=Bos taurus GN=PDIA3 PE=2 SV=1 1 90 8.0E-07
sp|P52589|PDI_WHEAT Protein disulfide-isomerase OS=Triticum aestivum GN=PDI PE=2 SV=1 1 98 8.0E-07
sp|Q3TMX7|QSOX2_MOUSE Sulfhydryl oxidase 2 OS=Mus musculus GN=Qsox2 PE=1 SV=1 9 80 8.0E-07
sp|Q9XI01|PDI11_ARATH Protein disulfide isomerase-like 1-1 OS=Arabidopsis thaliana GN=PDIL1-1 PE=1 SV=1 11 108 9.0E-07
sp|Q6AX23|QSOX2_XENLA Sulfhydryl oxidase 2 OS=Xenopus laevis GN=qsox2 PE=2 SV=1 2 86 9.0E-07
sp|Q94F09|PDI52_ARATH Protein disulfide-isomerase 5-2 OS=Arabidopsis thaliana GN=PDIL5-2 PE=1 SV=1 5 258 1.0E-06
sp|P23400|TRXM_CHLRE Thioredoxin M-type, chloroplastic OS=Chlamydomonas reinhardtii GN=TRXM PE=1 SV=3 1 96 1.0E-06
sp|Q8JG64|PDIA3_CHICK Protein disulfide-isomerase A3 OS=Gallus gallus GN=PDIA3 PE=2 SV=1 10 90 2.0E-06
sp|Q0Z7W6|TMX1_BOVIN Thioredoxin-related transmembrane protein 1 OS=Bos taurus GN=TMX1 PE=2 SV=1 9 90 2.0E-06
sp|Q8JGM4|QSOX1_CHICK Sulfhydryl oxidase 1 OS=Gallus gallus GN=QSOX1 PE=1 SV=1 9 82 2.0E-06
sp|P59527|THIO_BUCBP Thioredoxin OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=trxA PE=3 SV=1 10 74 3.0E-06
sp|Q14554|PDIA5_HUMAN Protein disulfide-isomerase A5 OS=Homo sapiens GN=PDIA5 PE=1 SV=1 1 200 3.0E-06
sp|P08058|THIO_RHOSH Thioredoxin OS=Rhodobacter sphaeroides GN=trxA PE=1 SV=3 2 74 3.0E-06
sp|P54399|PDI_DROME Protein disulfide-isomerase OS=Drosophila melanogaster GN=Pdi PE=2 SV=1 10 90 4.0E-06
sp|Q9H3N1|TMX1_HUMAN Thioredoxin-related transmembrane protein 1 OS=Homo sapiens GN=TMX1 PE=1 SV=1 9 90 4.0E-06
sp|Q9SRG3|PDI12_ARATH Protein disulfide isomerase-like 1-2 OS=Arabidopsis thaliana GN=PDIL1-2 PE=2 SV=1 11 99 5.0E-06
sp|Q2KIL5|PDIA5_BOVIN Protein disulfide-isomerase A5 OS=Bos taurus GN=PDIA5 PE=2 SV=1 1 200 5.0E-06
sp|Q5I0H9|PDIA5_RAT Protein disulfide-isomerase A5 OS=Rattus norvegicus GN=Pdia5 PE=2 SV=1 1 200 5.0E-06
sp|P10473|THIO_RHORU Thioredoxin OS=Rhodospirillum rubrum GN=trxA PE=1 SV=1 2 76 7.0E-06
sp|Q92JR5|THIO_RICCN Thioredoxin OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=trxA PE=3 SV=1 8 95 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0045454 cell redox homeostasis Yes
GO:0009987 cellular process No
GO:0050789 regulation of biological process No
GO:0008150 biological_process No
GO:0065007 biological regulation No
GO:0042592 homeostatic process No
GO:0019725 cellular homeostasis No
GO:0065008 regulation of biological quality No
GO:0050794 regulation of cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 392 414 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8846
LVTRTQDPWFIKFYVPWCHHCQALAPTWEQLAKSMQGRLNVAEVNCEKGKQEAALCRDVNVRGYPTVLFFKGAER
AEYTGLRGLGDFVQYAEKAMDLASGVPDVDAASFKQLEQKEDVIFVYFYDHATTSEDFQALERLPLSLIGHAKLV
KTKDPKLFDRFKITTWPRLVVSREGRPTYYPPLTPDEMRDVRGVLDWMRSVWLPLVPELSPSNARQVMDGKIVVL
GILNHDDHDAFHGSLREMKSAANEWMDRQIQEFQLERKKLRDSKQMRIEEAEDRDDQRALRAAKAIRVNMDTSGR
KEVMFAWVDGVYWQRWIRTTYGVDVKDGERIIINDEDNRRYWDNTVTGNYILVSRTSIMETLDKIVYGPNVIKYK
LTVSAPEKLLFDIRVAFSEHPFLSFGCVAGIGFGIFSWLRGRNRRRGGHFRLDDSMGIRELKDGLMGVNGNQKAD
*
Coding >Hirsu2|8846
CTGGTCACCAGGACGCAGGATCCTTGGTTCATCAAGTTCTACGTCCCGTGGTGCCACCACTGCCAGGCCCTGGCC
CCCACCTGGGAGCAGCTGGCCAAGTCGATGCAGGGCAGGCTCAACGTCGCCGAGGTCAACTGCGAAAAAGGCAAG
CAGGAGGCGGCGCTGTGCCGCGACGTCAACGTCCGCGGCTACCCCACCGTCCTCTTCTTCAAGGGCGCCGAGCGG
GCCGAGTACACCGGCCTCCGAGGCCTCGGCGACTTCGTCCAGTACGCCGAGAAGGCCATGGACCTCGCCAGCGGC
GTGCCCGACGTCGATGCCGCCTCGTTCAAGCAGTTGGAGCAGAAGGAGGACGTCATCTTCGTCTACTTCTACGAC
CACGCCACCACCAGCGAGGACTTCCAGGCGCTCGAGAGGCTCCCCCTGAGCCTCATCGGCCACGCCAAGCTGGTC
AAGACGAAGGATCCCAAGCTCTTCGACCGCTTCAAGATCACCACCTGGCCCAGGCTCGTCGTCTCGCGAGAGGGC
CGTCCGACCTACTACCCGCCGCTGACGCCGGACGAGATGAGAGACGTGCGCGGCGTCCTCGACTGGATGCGGTCC
GTGTGGCTGCCGCTCGTGCCCGAGCTGTCGCCCTCGAACGCGCGCCAGGTCATGGACGGCAAGATCGTCGTCCTC
GGCATCCTCAACCACGACGACCACGACGCCTTCCACGGCTCGCTGCGCGAGATGAAGAGCGCGGCCAACGAGTGG
ATGGACCGGCAGATCCAGGAGTTCCAGCTGGAGAGGAAGAAGCTGCGCGACTCGAAGCAGATGAGGATCGAGGAG
GCCGAGGACCGCGACGACCAACGGGCCCTGCGGGCGGCCAAGGCCATCCGCGTCAACATGGACACGTCGGGCCGC
AAGGAGGTCATGTTCGCCTGGGTCGACGGCGTGTACTGGCAGCGCTGGATCCGCACCACGTACGGCGTCGACGTC
AAGGACGGAGAGCGCATCATCATCAACGACGAGGACAACCGGAGATACTGGGACAACACCGTGACCGGCAACTAC
ATCCTCGTCTCGCGCACGTCCATCATGGAGACGCTGGACAAGATCGTCTACGGCCCCAACGTGATCAAGTACAAG
CTGACCGTGTCGGCGCCGGAGAAGCTGCTGTTCGACATCCGCGTCGCCTTCTCGGAGCACCCGTTCCTGTCCTTC
GGCTGCGTCGCCGGCATCGGCTTCGGCATCTTCTCCTGGCTGCGCGGGCGCAACCGCCGCCGCGGCGGCCACTTC
CGGCTCGACGACAGCATGGGCATCAGGGAGCTGAAGGATGGCCTGATGGGCGTCAACGGCAACCAGAAGGCCGAC
TGA
Transcript >Hirsu2|8846
CTGGTCACCAGGACGCAGGATCCTTGGTTCATCAAGTTCTACGTCCCGTGGTGCCACCACTGCCAGGCCCTGGCC
CCCACCTGGGAGCAGCTGGCCAAGTCGATGCAGGGCAGGCTCAACGTCGCCGAGGTCAACTGCGAAAAAGGCAAG
CAGGAGGCGGCGCTGTGCCGCGACGTCAACGTCCGCGGCTACCCCACCGTCCTCTTCTTCAAGGGCGCCGAGCGG
GCCGAGTACACCGGCCTCCGAGGCCTCGGCGACTTCGTCCAGTACGCCGAGAAGGCCATGGACCTCGCCAGCGGC
GTGCCCGACGTCGATGCCGCCTCGTTCAAGCAGTTGGAGCAGAAGGAGGACGTCATCTTCGTCTACTTCTACGAC
CACGCCACCACCAGCGAGGACTTCCAGGCGCTCGAGAGGCTCCCCCTGAGCCTCATCGGCCACGCCAAGCTGGTC
AAGACGAAGGATCCCAAGCTCTTCGACCGCTTCAAGATCACCACCTGGCCCAGGCTCGTCGTCTCGCGAGAGGGC
CGTCCGACCTACTACCCGCCGCTGACGCCGGACGAGATGAGAGACGTGCGCGGCGTCCTCGACTGGATGCGGTCC
GTGTGGCTGCCGCTCGTGCCCGAGCTGTCGCCCTCGAACGCGCGCCAGGTCATGGACGGCAAGATCGTCGTCCTC
GGCATCCTCAACCACGACGACCACGACGCCTTCCACGGCTCGCTGCGCGAGATGAAGAGCGCGGCCAACGAGTGG
ATGGACCGGCAGATCCAGGAGTTCCAGCTGGAGAGGAAGAAGCTGCGCGACTCGAAGCAGATGAGGATCGAGGAG
GCCGAGGACCGCGACGACCAACGGGCCCTGCGGGCGGCCAAGGCCATCCGCGTCAACATGGACACGTCGGGCCGC
AAGGAGGTCATGTTCGCCTGGGTCGACGGCGTGTACTGGCAGCGCTGGATCCGCACCACGTACGGCGTCGACGTC
AAGGACGGAGAGCGCATCATCATCAACGACGAGGACAACCGGAGATACTGGGACAACACCGTGACCGGCAACTAC
ATCCTCGTCTCGCGCACGTCCATCATGGAGACGCTGGACAAGATCGTCTACGGCCCCAACGTGATCAAGTACAAG
CTGACCGTGTCGGCGCCGGAGAAGCTGCTGTTCGACATCCGCGTCGCCTTCTCGGAGCACCCGTTCCTGTCCTTC
GGCTGCGTCGCCGGCATCGGCTTCGGCATCTTCTCCTGGCTGCGCGGGCGCAACCGCCGCCGCGGCGGCCACTTC
CGGCTCGACGACAGCATGGGCATCAGGGAGCTGAAGGATGGCCTGATGGGCGTCAACGGCAACCAGAAGGCCGAC
TGA
Gene >Hirsu2|8846
CTGGTCACCAGGACGCAGGATCCTTGGTTCATCAAGTTCTACGTCCCGTGGTGCCACCACTGCCAGGCCCTGGCC
CCCACCTGGGAGCAGCTGGCCAAGTCGATGCAGGGCAGGCTCAACGTCGCCGAGGTCAACTGCGAAAAAGGCAAG
CAGGAGGCGGCGCTGTGCCGCGACGTCAACGTCCGCGGCTACCCCACCGTCCTCTTCTTCAAGGGCGCCGAGCGG
GCCGAGTACACCGGCCTCCGAGGCCTCGGCGACTTCGTCCAGTACGCCGAGAAGGCCATGGACCTCGCCAGCGGC
GTGCCCGACGTCGATGCCGCCTCGTTCAAGCAGTTGGAGCAGAAGGAGGACGTCATCTTCGTCTACTTCTACGAC
CACGCCACCACCAGCGAGGACTTCCAGGCGCTCGAGAGGCTCCCCCTGAGCCTCATCGGCCACGCCAAGCTGGTC
AAGACGAAGGATCCCAAGCTCTTCGACCGCTTCAAGATCACCACCTGGCCCAGGCTCGTCGTCTCGCGAGAGGGC
CGTCCGACCTACTACCCGCCGCTGACGCCGGACGAGATGAGAGACGTGCGCGGCGTCCTCGACTGGATGCGGTCC
GTGTGGCTGCCGCTCGTGCCCGAGCTGTCGCCCTCGAACGCGCGCCAGGTCATGGACGGCAAGATCGTCGTCCTC
GGCATCCTCAACCACGACGACCACGACGCCTTCCACGGCTCGCTGCGCGAGATGAAGAGCGCGGCCAACGAGTGG
ATGGACCGGCAGATCCAGGAGTTCCAGCTGGAGAGGAAGAAGCTGCGCGACTCGAAGCAGATGAGGATCGAGGAG
GCCGAGGACCGCGACGACCAACGGGCCCTGCGGGCGGCCAAGGCCATCCGCGTCAACATGGACACGTCGGGCCGC
AAGGAGGTCATGTTCGCCTGGGTCGACGGCGTGTACTGGCAGCGCTGGATCCGCACCACGTACGGCGTCGACGTC
AAGGACGGAGAGCGCATCATCATCAACGACGAGGACGTGAGTGTTTGCGGATCGCATCTCTCCTCCCCCCCCCCC
CCAAACCTCTGCGACGCTAACCAAGCACGACCGAACAGAACCGGAGATACTGGGACAACACCGTGACCGGCAACT
ACATCCTCGTCTCGCGCACGTCCATCATGGAGACGCTGGACAAGATCGTCTACGGCCCCAACGTGATCAAGTACA
AGCTGACCGTGTCGGCGCCGGAGAAGCTGCTGTTCGACATCCGCGTCGCCTTCTCGGAGCACCCGTTCCTGTCCT
TCGGCTGCGTCGCCGGCATCGGCTTCGGCATCTTCTCCTGGCTGCGCGGGCGCAACCGCCGCCGCGGCGGCCACT
TCCGGCTCGACGACAGCATGGGCATCAGGGAGCTGAAGGATGGCCTGATGGGCGTCAACGGCAACCAGAAGGCCG
ACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail