Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8844
Gene name
LocationContig_601:13143..14257
Strand+
Gene length (bp)1114
Transcript length (bp)942
Coding sequence length (bp)942
Protein length (aa) 314

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03162 Y_phosphatase2 Tyrosine phosphatase family 3.1E-42 118 265
PF13350 Y_phosphatase3 Tyrosine phosphatase family 2.6E-08 136 242

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZVN4|Y1500_ARATH Probable tyrosine-protein phosphatase At1g05000 OS=Arabidopsis thaliana GN=At1g05000 PE=1 SV=1 119 265 3.0E-31
sp|P53965|SIW14_YEAST Tyrosine-protein phosphatase SIW14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIW14 PE=1 SV=1 119 269 6.0E-29
sp|Q1ZXG8|D1060_DICDI Probable tyrosine-protein phosphatase DG1060 OS=Dictyostelium discoideum GN=DG1060 PE=3 SV=1 116 265 2.0E-25
sp|Q9UUF3|YNF3_SCHPO Probable tyrosine-protein phosphatase C17A3.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi043 PE=1 SV=3 119 262 2.0E-25
sp|P53949|OCA2_YEAST Tyrosine-protein phosphatase-like protein OCA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OCA2 PE=1 SV=1 119 263 9.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZVN4|Y1500_ARATH Probable tyrosine-protein phosphatase At1g05000 OS=Arabidopsis thaliana GN=At1g05000 PE=1 SV=1 119 265 3.0E-31
sp|P53965|SIW14_YEAST Tyrosine-protein phosphatase SIW14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIW14 PE=1 SV=1 119 269 6.0E-29
sp|Q1ZXG8|D1060_DICDI Probable tyrosine-protein phosphatase DG1060 OS=Dictyostelium discoideum GN=DG1060 PE=3 SV=1 116 265 2.0E-25
sp|Q9UUF3|YNF3_SCHPO Probable tyrosine-protein phosphatase C17A3.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi043 PE=1 SV=3 119 262 2.0E-25
sp|P53949|OCA2_YEAST Tyrosine-protein phosphatase-like protein OCA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OCA2 PE=1 SV=1 119 263 9.0E-24
sp|Q6C4X9|OCA1_YARLI Putative tyrosine-protein phosphatase OCA1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=OCA1 PE=3 SV=1 121 265 8.0E-23
sp|A5DE24|OCA1_PICGU Putative tyrosine-protein phosphatase OCA1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=OCA1 PE=3 SV=2 119 265 9.0E-20
sp|Q6BLZ8|OCA1_DEBHA Putative tyrosine-protein phosphatase OCA1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=OCA1 PE=3 SV=1 98 275 1.0E-18
sp|A3LW52|OCA1_PICST Putative tyrosine-protein phosphatase OCA1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=OCA1 PE=3 SV=1 119 275 5.0E-18
sp|Q6FSZ8|OCA1_CANGA Putative tyrosine-protein phosphatase OCA1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=OCA1 PE=3 SV=1 119 266 3.0E-17
sp|Q75B37|OCA1_ASHGO Putative tyrosine-protein phosphatase OCA1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=OCA1 PE=3 SV=1 82 265 1.0E-16
sp|P50946|OCA1_YEAST Putative tyrosine-protein phosphatase OCA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OCA1 PE=1 SV=1 119 266 1.0E-16
sp|A6ZRY1|OCA1_YEAS7 Putative tyrosine-protein phosphatase OCA1 OS=Saccharomyces cerevisiae (strain YJM789) GN=OCA1 PE=3 SV=1 119 266 1.0E-16
sp|Q4P7L6|OCA1_USTMA Putative tyrosine-protein phosphatase OCA1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=OCA1 PE=3 SV=1 119 265 4.0E-16
sp|Q6CTE4|OCA1_KLULA Putative tyrosine-protein phosphatase OCA1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=OCA1 PE=3 SV=1 119 266 4.0E-15
sp|Q12454|OCA6_YEAST Putative tyrosine-protein phosphatase OCA6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OCA6 PE=1 SV=1 119 262 2.0E-13
sp|Q59XY9|OCA1_CANAL Putative tyrosine-protein phosphatase OCA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=OCA1 PE=3 SV=1 192 248 6.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

Domain # Start End Length
1 283 300 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8844
MASKRNSRVFVDEAKHRDAGHHKPTASAHRSRRDSHGSVKDETTAPGQDADGGQRIAPVVKDATASAPRSRSTSS
GSREALVTSSARIGDKTAAAATSTKASIATRVAECPSVPLHGRPANFGLVIPGLYRSSYPTPDDYAFLQSLHLKT
VVTLVKRDDVDHELETFASSNGIRHVVFDMRGTKKEAIPVATMTSILRVVLDRQHYPLLLHCNHGKHRTGCVVAI
VRKLSGWGLDSTLDEYRTYAAPKVRECDVDYISGFDSSSIRALSLEPSRISPVQVRTFFRTLLFSTFVMVLWLVS
GSKMPLPPNDLVA*
Coding >Hirsu2|8844
ATGGCCTCCAAGAGAAATTCACGCGTCTTCGTCGACGAGGCGAAACACCGGGATGCGGGCCACCACAAGCCCACT
GCCTCGGCCCACCGCTCCAGACGCGACTCGCACGGCTCCGTCAAGGACGAAACGACGGCACCGGGCCAGGATGCC
GACGGTGGGCAACGCATCGCACCCGTCGTCAAGGACGCAACCGCCTCGGCCCCCCGTTCTCGGAGCACCAGTTCT
GGGAGTCGCGAGGCATTGGTCACGTCCAGCGCCAGAATCGGCGATAAGACGGCTGCTGCTGCAACCTCGACCAAA
GCGTCCATCGCGACACGGGTGGCCGAGTGCCCATCCGTTCCCCTGCACGGCCGGCCGGCCAATTTTGGTCTGGTC
ATCCCCGGCCTCTATCGCAGCAGCTATCCTACGCCCGACGACTACGCTTTCTTGCAGAGCCTCCACCTCAAGACA
GTCGTGACCCTGGTCAAGAGGGACGATGTCGACCATGAGCTCGAGACCTTCGCCAGCAGTAACGGCATCCGCCAC
GTCGTCTTCGACATGAGAGGCACCAAAAAAGAGGCCATCCCCGTAGCCACCATGACATCCATCCTGCGCGTCGTC
CTGGACCGTCAACATTACCCCCTTTTGCTGCACTGCAACCACGGCAAACACCGCACCGGCTGCGTCGTCGCCATC
GTGCGAAAGCTTTCCGGTTGGGGCCTGGACAGCACGCTGGACGAGTACAGGACGTACGCGGCCCCCAAGGTCCGC
GAGTGCGACGTCGACTACATCAGCGGCTTCGACTCGTCGTCCATCCGTGCCCTGTCCTTGGAACCGTCGCGCATC
AGTCCGGTCCAGGTCCGGACCTTTTTCCGCACCCTGCTCTTCTCCACGTTCGTCATGGTGCTCTGGCTGGTCTCG
GGGTCCAAGATGCCGTTACCGCCCAACGACCTGGTCGCCTGA
Transcript >Hirsu2|8844
ATGGCCTCCAAGAGAAATTCACGCGTCTTCGTCGACGAGGCGAAACACCGGGATGCGGGCCACCACAAGCCCACT
GCCTCGGCCCACCGCTCCAGACGCGACTCGCACGGCTCCGTCAAGGACGAAACGACGGCACCGGGCCAGGATGCC
GACGGTGGGCAACGCATCGCACCCGTCGTCAAGGACGCAACCGCCTCGGCCCCCCGTTCTCGGAGCACCAGTTCT
GGGAGTCGCGAGGCATTGGTCACGTCCAGCGCCAGAATCGGCGATAAGACGGCTGCTGCTGCAACCTCGACCAAA
GCGTCCATCGCGACACGGGTGGCCGAGTGCCCATCCGTTCCCCTGCACGGCCGGCCGGCCAATTTTGGTCTGGTC
ATCCCCGGCCTCTATCGCAGCAGCTATCCTACGCCCGACGACTACGCTTTCTTGCAGAGCCTCCACCTCAAGACA
GTCGTGACCCTGGTCAAGAGGGACGATGTCGACCATGAGCTCGAGACCTTCGCCAGCAGTAACGGCATCCGCCAC
GTCGTCTTCGACATGAGAGGCACCAAAAAAGAGGCCATCCCCGTAGCCACCATGACATCCATCCTGCGCGTCGTC
CTGGACCGTCAACATTACCCCCTTTTGCTGCACTGCAACCACGGCAAACACCGCACCGGCTGCGTCGTCGCCATC
GTGCGAAAGCTTTCCGGTTGGGGCCTGGACAGCACGCTGGACGAGTACAGGACGTACGCGGCCCCCAAGGTCCGC
GAGTGCGACGTCGACTACATCAGCGGCTTCGACTCGTCGTCCATCCGTGCCCTGTCCTTGGAACCGTCGCGCATC
AGTCCGGTCCAGGTCCGGACCTTTTTCCGCACCCTGCTCTTCTCCACGTTCGTCATGGTGCTCTGGCTGGTCTCG
GGGTCCAAGATGCCGTTACCGCCCAACGACCTGGTCGCCTGA
Gene >Hirsu2|8844
ATGGCCTCCAAGAGAAATTCACGCGTCTTCGTCGACGAGGCGAAACACCGGGATGCGGGCCACCACAAGCCCACT
GCCTCGGCCCACCGCTCCAGACGCGACTCGCACGGCTCCGTCAAGGACGAAACGACGGCACCGGGCCAGGATGCC
GACGGTGGGCAACGCATCGCACCCGTCGTCAAGGACGCAACCGCCTCGGCCCCCCGTTCTCGGAGCACCAGTTCT
GGGAGTCGCGAGGCATTGGTCACGTCCAGCGCCAGAATCGGCGATAAGACGGGTAAGCTGACCCTCGCCCCTGTC
CCGTCCCGACTCTTGTTCAGGCCCGCCCGCTGACACGACGCCCTCGGCCAGCTGCTGCTGCAACCTCGACCAAAG
CGTCCATCGCGACACGGGTGGCCGAGTGCCCATCCGTTCCCCTGCACGGCCGGCCGGCCAATTTTGGTCTGGTCA
TCCCCGGCCTCTATCGCAGCAGCTATCCTACGCCCGACGACTACGCTTTCTTGCAGAGCCTCCACCTCAAGACAG
TCGTGTAAGCCCCCCCACTGTACCTGCATGCCTTCTTCCCCGGCCCGACCTGCTCTTCGCACCACGTTCCCCCCT
TCCCCCGTGCTGACGCCGTCACGGCAGGACCCTGGTCAAGAGGGACGATGTCGACCATGAGCTCGAGACCTTCGC
CAGCAGTAACGGCATCCGCCACGTCGTCTTCGACATGAGAGGCACCAAAAAAGAGGCCATCCCCGTAGCCACCAT
GACATCCATCCTGCGCGTCGTCCTGGACCGTCAACATTACCCCCTTTTGCTGCACTGCAACCACGGCAAACACCG
CACCGGCTGCGTCGTCGCCATCGTGCGAAAGCTTTCCGGTTGGGGCCTGGACAGCACGCTGGACGAGTACAGGAC
GTACGCGGCCCCCAAGGTCCGCGAGTGCGACGTCGACTACATCAGCGGCTTCGACTCGTCGTCCATCCGTGCCCT
GTCCTTGGAACCGTCGCGCATCAGTCCGGTCCAGGTCCGGACCTTTTTCCGCACCCTGCTCTTCTCCACGTTCGT
CATGGTGCTCTGGCTGGTCTCGGGGTCCAAGATGCCGTTACCGCCCAACGACCTGGTCGCCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail