Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8833
Gene name
LocationContig_600:4446..4988
Strand-
Gene length (bp)542
Transcript length (bp)462
Coding sequence length (bp)462
Protein length (aa) 154

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01284 MARVEL Membrane-associating domain 4.2E-14 8 135

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 9 31 22
2 41 63 22
3 83 105 22
4 120 142 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8833
MAALDRIVSFILRGAQLAFAVICVAILAHYLSQSPQSDDPAFARFIYTIVTAGISVLVSLVLLLPFSGTFTSWPT
DIFISLMWWAAFAILVDLIGSSCGAIFYWGNIAPRGDQCGRFKAVIAFSFLSAIVWLAMAGIGLFWVRRHRQRRT
SRV*
Coding >Hirsu2|8833
ATGGCGGCGTTAGATCGCATCGTGAGCTTCATCCTTCGCGGGGCGCAGCTAGCCTTCGCCGTCATCTGCGTCGCG
ATCCTGGCCCACTACCTCAGCCAGTCGCCGCAGAGCGACGACCCGGCCTTTGCCCGCTTCATCTACACCATCGTC
ACGGCCGGTATCTCCGTCCTGGTCAGCCTGGTGCTGCTGCTGCCCTTCTCCGGCACCTTTACCTCATGGCCAACC
GACATCTTCATCAGCCTGATGTGGTGGGCGGCCTTTGCCATCCTCGTCGATCTCATCGGATCCTCCTGCGGCGCC
ATCTTCTACTGGGGCAACATCGCGCCGCGGGGAGACCAGTGCGGCAGATTCAAGGCCGTCATCGCCTTCTCCTTC
CTCTCCGCCATCGTATGGCTTGCCATGGCCGGAATCGGTCTGTTCTGGGTCCGCCGCCATCGCCAGCGCCGGACA
TCTCGCGTTTGA
Transcript >Hirsu2|8833
ATGGCGGCGTTAGATCGCATCGTGAGCTTCATCCTTCGCGGGGCGCAGCTAGCCTTCGCCGTCATCTGCGTCGCG
ATCCTGGCCCACTACCTCAGCCAGTCGCCGCAGAGCGACGACCCGGCCTTTGCCCGCTTCATCTACACCATCGTC
ACGGCCGGTATCTCCGTCCTGGTCAGCCTGGTGCTGCTGCTGCCCTTCTCCGGCACCTTTACCTCATGGCCAACC
GACATCTTCATCAGCCTGATGTGGTGGGCGGCCTTTGCCATCCTCGTCGATCTCATCGGATCCTCCTGCGGCGCC
ATCTTCTACTGGGGCAACATCGCGCCGCGGGGAGACCAGTGCGGCAGATTCAAGGCCGTCATCGCCTTCTCCTTC
CTCTCCGCCATCGTATGGCTTGCCATGGCCGGAATCGGTCTGTTCTGGGTCCGCCGCCATCGCCAGCGCCGGACA
TCTCGCGTTTGA
Gene >Hirsu2|8833
ATGGCGGCGTTAGATCGCATCGTGAGCTTCATCCTTCGCGGGGCGCAGCTAGCCTTCGCCGTCATCTGCGTCGCG
ATCCTGGCCCACTACCTCAGCCAGTCGCCGCAGAGCGACGACCCGGCCTTTGCCCGCTTCATCTACACCATCGTC
ACGGCCGGTATCTCCGTCCTGGTCAGCCTGGTGCTGCTGCTGCCCTTCTCCGGCACCTTTACCTCATGGCCAACC
GACATCTTCATCAGCCTGATGTGGTGGGCGGCCTTTGCCATCCTCGTCGATGTGAGTCTCGTCCCTCCTCTTTGT
CTCTCCCGGTTTCGATGGCTCGAGAATGGGGCAGGCTGCTCTGACACGCCCGGTAGCTCATCGGATCCTCCTGCG
GCGCCATCTTCTACTGGGGCAACATCGCGCCGCGGGGAGACCAGTGCGGCAGATTCAAGGCCGTCATCGCCTTCT
CCTTCCTCTCCGCCATCGTATGGCTTGCCATGGCCGGAATCGGTCTGTTCTGGGTCCGCCGCCATCGCCAGCGCC
GGACATCTCGCGTTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail