Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8828
Gene name
LocationContig_60:45365..47222
Strand+
Gene length (bp)1857
Transcript length (bp)1857
Coding sequence length (bp)1857
Protein length (aa) 619

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 3.9E-24 155 467
PF00067 p450 Cytochrome P450 2.6E-07 495 562

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 301 558 5.0E-19
sp|P33268|CP3A8_MACFA Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 285 557 1.0E-18
sp|P24462|CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 293 545 9.0E-18
sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 293 545 1.0E-17
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 301 557 1.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 301 558 5.0E-19
sp|P33268|CP3A8_MACFA Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 285 557 1.0E-18
sp|P24462|CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 293 545 9.0E-18
sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 293 545 1.0E-17
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 301 557 1.0E-17
sp|O09158|CP3AP_MOUSE Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 91 558 3.0E-17
sp|Q9VA27|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 316 566 6.0E-17
sp|P05183|CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 145 557 6.0E-17
sp|Q64148|CP3AA_MESAU Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 301 552 2.0E-16
sp|Q64581|CP3AI_RAT Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 301 552 2.0E-16
sp|P20815|CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 91 545 3.0E-16
sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 316 560 3.0E-16
sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 316 560 4.0E-16
sp|P04800|CP3A1_RAT Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 145 557 5.0E-16
sp|O18993|CP3AL_CALJA Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 293 545 6.0E-16
sp|Q9VLZ7|C4D21_DROME Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 95 596 6.0E-16
sp|Q6A152|CP4X1_MOUSE Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 113 559 1.0E-15
sp|Q86W10|CP4Z1_HUMAN Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 109 552 1.0E-15
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 290 560 4.0E-15
sp|P79102|CP3AS_BOVIN Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 289 557 4.0E-15
sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 301 560 5.0E-15
sp|Q64406|CP3AF_CAVPO Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 302 557 7.0E-15
sp|O42563|CP3AR_ONCMY Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 335 560 9.0E-15
sp|Q27589|CP4D2_DROME Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 116 564 6.0E-14
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 293 552 7.0E-14
sp|O70537|CP3AV_MESAU Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 295 558 9.0E-14
sp|Q64481|CP3AG_MOUSE Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 301 545 1.0E-13
sp|Q8SPK0|CP4AP_PIG Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 210 554 1.0E-13
sp|Q64417|CP3AE_CAVPO Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 302 557 1.0E-13
sp|P79401|CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 289 552 1.0E-13
sp|P15128|CP4B1_RABIT Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 122 550 2.0E-13
sp|Q9JMA7|CP341_MOUSE Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 145 557 2.0E-13
sp|Q8K4D6|CP4X1_RAT Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 113 564 2.0E-13
sp|Q64409|CP3AH_CAVPO Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 286 557 3.0E-13
sp|Q27519|C13A7_CAEEL Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 152 557 3.0E-13
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 289 552 3.0E-13
sp|P20816|CP4A2_RAT Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 292 554 5.0E-13
sp|Q8SPK1|CP4AO_PIG Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 210 554 7.0E-13
sp|Q9HB55|CP343_HUMAN Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 291 552 8.0E-13
sp|P79152|CP3AJ_CAPHE Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 337 557 1.0E-12
sp|P36423|THAS_MOUSE Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 PE=1 SV=2 339 545 1.0E-12
sp|P20817|CP4AE_RAT Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a14 PE=1 SV=2 292 554 1.0E-12
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 295 557 2.0E-12
sp|Q5RCN6|CP4V2_PONAB Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 309 612 2.0E-12
sp|Q9GJX5|CP4AL_PIG Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 210 550 3.0E-12
sp|P51590|CP2J3_RAT Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 310 554 3.0E-12
sp|O23365|C97B3_ARATH Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 335 578 4.0E-12
sp|P14581|CP4A7_RABIT Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 163 554 5.0E-12
sp|Q27593|CP6A8_DROME Cytochrome P450 6a8 OS=Drosophila melanogaster GN=Cyp6a8 PE=2 SV=2 89 544 6.0E-12
sp|Q9VB31|C6A18_DROME Probable cytochrome P450 6a18 OS=Drosophila melanogaster GN=Cyp6a18 PE=2 SV=1 156 566 7.0E-12
sp|Q7KWN2|C525A_DICDI Probable cytochrome P450 525A1 OS=Dictyostelium discoideum GN=cyp525A1 PE=3 SV=1 338 552 1.0E-11
sp|Q5TCH4|CP4AM_HUMAN Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE=1 SV=1 292 545 1.0E-11
sp|P49430|THAS_RAT Thromboxane-A synthase OS=Rattus norvegicus GN=Tbxas1 PE=2 SV=1 331 545 2.0E-11
sp|P08516|CP4AA_RAT Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 316 550 2.0E-11
sp|Q9W011|C4D20_DROME Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 316 558 2.0E-11
sp|P10611|CP4A4_RABIT Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 108 554 3.0E-11
sp|O48927|C78A3_SOYBN Cytochrome P450 78A3 OS=Glycine max GN=CYP78A3 PE=2 SV=1 104 494 3.0E-11
sp|Q02928|CP4AB_HUMAN Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE=1 SV=1 292 554 3.0E-11
sp|O54750|CP2J6_MOUSE Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 291 554 3.0E-11
sp|P78329|CP4F2_HUMAN Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 320 598 3.0E-11
sp|O35728|CP4AE_MOUSE Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 292 554 3.0E-11
sp|Q5KQH7|C14D1_ORYSJ Cytochrome P450 714D1 OS=Oryza sativa subsp. japonica GN=CYP714D1 PE=1 SV=1 118 599 3.0E-11
sp|Q27517|C13A3_CAEEL Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 155 558 4.0E-11
sp|Q9HBI6|CP4FB_HUMAN Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 335 598 4.0E-11
sp|H2DH21|C7A29_PANGI Cytochrome P450 CYP72A219 OS=Panax ginseng PE=2 SV=1 106 560 5.0E-11
sp|O88833|CP4AA_MOUSE Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 335 550 7.0E-11
sp|Q9V7G5|C4AA1_DROME Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2 303 563 9.0E-11
sp|Q6ZWL3|CP4V2_HUMAN Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 309 582 2.0E-10
sp|Q27513|C13A4_CAEEL Putative cytochrome P450 CYP13A4 OS=Caenorhabditis elegans GN=cyp-13A4 PE=3 SV=1 339 557 2.0E-10
sp|P47787|THAS_PIG Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 304 545 2.0E-10
sp|Q9DBG1|CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 332 583 2.0E-10
sp|P15129|CP4B1_RAT Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 122 550 3.0E-10
sp|Q08477|CP4F3_HUMAN Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 320 598 3.0E-10
sp|O48921|C97B2_SOYBN Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 337 564 4.0E-10
sp|P24557|THAS_HUMAN Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 326 545 4.0E-10
sp|P51589|CP2J2_HUMAN Cytochrome P450 2J2 OS=Homo sapiens GN=CYP2J2 PE=1 SV=2 283 554 6.0E-10
sp|Q64462|CP4B1_MOUSE Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 116 550 7.0E-10
sp|P14579|CP4A5_RABIT Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 335 554 9.0E-10
sp|Q27514|C13A5_CAEEL Putative cytochrome P450 CYP13A5 OS=Caenorhabditis elegans GN=cyp-13A5 PE=3 SV=1 329 557 1.0E-09
sp|P14580|CP4A6_RABIT Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 335 554 2.0E-09
sp|P17178|CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 334 583 3.0E-09
sp|Q9VW43|CP305_DROME Probable cytochrome P450 305a1 OS=Drosophila melanogaster GN=Cyp305a1 PE=2 SV=1 230 563 4.0E-09
sp|Q09736|CP51_SCHPO Lanosterol 14-alpha demethylase erg11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg11 PE=1 SV=1 335 562 4.0E-09
sp|Q27518|C13A2_CAEEL Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 335 557 4.0E-09
sp|Q43078|C97B1_PEA Cytochrome P450 97B1, chloroplastic OS=Pisum sativum GN=CYP97B1 PE=2 SV=1 337 554 6.0E-09
sp|Q9VG82|CP9F2_DROME Probable cytochrome P450 9f2 OS=Drosophila melanogaster GN=Cyp9f2 PE=2 SV=1 336 559 8.0E-09
sp|P11714|CP2D9_MOUSE Cytochrome P450 2D9 OS=Mus musculus GN=Cyp2d9 PE=1 SV=2 350 563 8.0E-09
sp|Q9EP75|CP4FE_MOUSE Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 288 598 1.0E-08
sp|E9Q816|CP2W1_MOUSE Cytochrome P450 2W1 OS=Mus musculus GN=Cyp2w1 PE=2 SV=1 334 565 1.0E-08
sp|Q9LMM1|C86A4_ARATH Cytochrome P450 86A4 OS=Arabidopsis thaliana GN=CYP86A4 PE=1 SV=1 111 563 2.0E-08
sp|Q9CX98|CP2U1_MOUSE Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 340 563 2.0E-08
sp|Q1ZXF5|C5084_DICDI Probable cytochrome P450 508A4 OS=Dictyostelium discoideum GN=cyp508A4 PE=3 SV=1 310 563 2.0E-08
sp|Q12664|CP51_PENIT Eburicol 14-alpha-demethylase OS=Penicillium italicum GN=CYP51 PE=3 SV=1 335 554 2.0E-08
sp|Q95036|CP6B5_PAPGL Cytochrome P450 6B5 (Fragment) OS=Papilio glaucus GN=CYP6B5 PE=2 SV=1 149 548 3.0E-08
sp|Q9V4U9|C6A13_DROME Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 146 545 3.0E-08
sp|Q27902|CP6B4_PAPGL Cytochrome P450 6B4 OS=Papilio glaucus GN=CYP6B4 PE=2 SV=1 149 548 4.0E-08
sp|Q6TBX7|LUT1_ARATH Carotene epsilon-monooxygenase, chloroplastic OS=Arabidopsis thaliana GN=CYP97C1 PE=1 SV=1 93 561 4.0E-08
sp|Q50EK4|C75A1_PINTA Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 339 573 5.0E-08
sp|O46054|C4AE1_DROME Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 94 425 6.0E-08
sp|Q556M5|C5081_DICDI Probable cytochrome P450 508A1 OS=Dictyostelium discoideum GN=cyp508A1-1 PE=3 SV=1 288 587 6.0E-08
sp|Q0IIF9|CP2U1_BOVIN Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 340 560 7.0E-08
sp|Q01361|CP2DE_BOVIN Cytochrome P450 2D14 OS=Bos taurus GN=CYP2D14 PE=2 SV=2 350 563 8.0E-08
sp|P9WPN3|CP132_MYCTU Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp132 PE=1 SV=1 310 563 9.0E-08
sp|Q964R1|CP6J1_BLAGE Cytochrome P450 6j1 OS=Blattella germanica GN=CYP6J1 PE=2 SV=1 316 559 9.0E-08
sp|B5BSX1|BAMO_GLYUR Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 107 562 1.0E-07
sp|Q4G0S4|C27C1_HUMAN Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=2 335 558 1.0E-07
sp|P9WPN2|CP132_MYCTO Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp132 PE=3 SV=1 310 563 1.0E-07
sp|P59954|CP132_MYCBO Putative cytochrome P450 132 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp132 PE=3 SV=1 310 563 1.0E-07
sp|P24456|CP2DA_MOUSE Cytochrome P450 2D10 OS=Mus musculus GN=Cyp2d10 PE=1 SV=2 298 563 2.0E-07
sp|Q29488|CP2DH_MACFA Cytochrome P450 2D17 OS=Macaca fascicularis GN=CYP2D17 PE=2 SV=1 350 563 3.0E-07
sp|O46658|CP2DP_PIG Vitamin D(3) 25-hydroxylase OS=Sus scrofa GN=CYP2D25 PE=1 SV=3 350 569 3.0E-07
sp|H2DH17|C7A22_PANGI Cytochrome P450 CYP749A22 OS=Panax ginseng PE=2 SV=1 294 560 3.0E-07
sp|P10635|CP2D6_HUMAN Cytochrome P450 2D6 OS=Homo sapiens GN=CYP2D6 PE=1 SV=2 350 563 3.0E-07
sp|Q9V9L1|CP6W1_DROME Probable cytochrome P450 6w1 OS=Drosophila melanogaster GN=Cyp6w1 PE=2 SV=1 158 556 4.0E-07
sp|Q9VCW1|CP6D4_DROME Probable cytochrome P450 6d4 OS=Drosophila melanogaster GN=Cyp6d4 PE=2 SV=1 340 562 4.0E-07
sp|P12789|CP2B5_RABIT Cytochrome P450 2B5 OS=Oryctolagus cuniculus GN=CYP2B5 PE=2 SV=1 275 566 4.0E-07
sp|Q2XNC9|CP2D6_PANPA Cytochrome P450 2D6 OS=Pan paniscus GN=CYP2D6 PE=3 SV=1 350 563 4.0E-07
sp|Q05047|C72A1_CATRO Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 340 544 5.0E-07
sp|Q2XNC8|CP2D6_PANTR Cytochrome P450 2D6 OS=Pan troglodytes GN=CYP2D6 PE=3 SV=1 363 563 6.0E-07
sp|Q27594|CP6A9_DROME Cytochrome P450 6a9 OS=Drosophila melanogaster GN=Cyp6a9 PE=2 SV=3 335 544 6.0E-07
sp|O65012|C78A4_PINRA Cytochrome P450 78A4 OS=Pinus radiata GN=CYP78A4 PE=2 SV=1 266 553 8.0E-07
sp|Q9QYG5|CP2DK_MESAU Cytochrome P450 2D20 OS=Mesocricetus auratus GN=CYP2D20 PE=2 SV=1 280 569 9.0E-07
sp|O18992|CP2DJ_CALJA Cytochrome P450 2D19 OS=Callithrix jacchus GN=CYP2D19 PE=2 SV=1 363 563 9.0E-07
sp|Q82IY3|PTLI_STRAW Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 315 553 1.0E-06
sp|P00178|CP2B4_RABIT Cytochrome P450 2B4 OS=Oryctolagus cuniculus GN=CYP2B4 PE=1 SV=1 275 566 1.0E-06
sp|Q2KIG5|THAS_BOVIN Thromboxane-A synthase OS=Bos taurus GN=TBXAS1 PE=2 SV=1 327 539 1.0E-06
sp|Q9ZNR0|C78A6_ARATH Cytochrome P450 78A6 OS=Arabidopsis thaliana GN=CYP78A6 PE=2 SV=1 95 572 2.0E-06
sp|P08686|CP21A_HUMAN Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 PE=1 SV=1 205 558 3.0E-06
sp|Q9V776|CP317_DROME Probable cytochrome P450 317a1 OS=Drosophila melanogaster GN=Cyp317a1 PE=3 SV=2 194 540 3.0E-06
sp|Q92113|CP17A_SQUAC Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 154 563 5.0E-06
sp|O15528|CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 335 558 6.0E-06
sp|Q9SLP1|C78A9_ARATH Cytochrome P450 78A9 OS=Arabidopsis thaliana GN=CYP78A9 PE=2 SV=1 102 553 7.0E-06
sp|P9WPM1|CP139_MYCTU Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp139 PE=1 SV=1 335 552 1.0E-05
sp|P9WPM0|CP139_MYCTO Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp139 PE=3 SV=1 335 552 1.0E-05
sp|P63720|CP139_MYCBO Putative cytochrome P450 139 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp139 PE=3 SV=1 335 552 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0020037 heme binding Yes
GO:0005506 iron ion binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0046872 metal ion binding No
GO:0016491 oxidoreductase activity No
GO:0046906 tetrapyrrole binding No
GO:0043169 cation binding No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8828
MIFEASATMNQLVAFSFWTLVASFLSFGIWSLIGLTHNIRLARATKLPYVILPYSLLGAPWQLTQCVVVPVAKLI
PKRLTREWLPLLLLNEFWHDGYEPFGRIKADTFLAASPGGLILYTCDPDVSTQLFRDGNFGKPTELMSVLNIYGP
TITGTDGPESRLYRKLTGPFFSDKTLRRVFVKSVSGAKILLAALTRPNAHRKLRTLSARLSLNTLSQICFRNQTD
SDLVKALAFEDDIPNGRTLSYSEALHGLIDNWNAIFLVPHWLLRLSPFRSHNHAAECYTELGSYMDQLKREKEGM
LSENSMHNTPNDPCTLLDLLVQAGLPSPGQANPLLANAQVIGQIFLFMFAGHEANANVVVSVILLLACHPHVQET
MQRDLDRVLGEKSPDTWSYDVHYSALMQTTVGAVINEALRLFSVIPVLPKYVPPRSPWPSISVQGQQHLLPPNTI
ALINTSATHRHPSYWPRRLSNTAEGDPAWTDIRNDPCQRPFAAADFDPSRWTEIDSAEDNDTASGGFLKPRVGTF
IPFSEGSRGCLGRRFALVEVCAVVSTLFKTHSVALISGPGDGSDVREAWLEARRRAALALSEGTEFGMSLRIERN
VPIKFIPRDQEEMPTCRF*
Coding >Hirsu2|8828
ATGATCTTCGAGGCTTCCGCCACCATGAACCAGCTCGTGGCTTTCAGTTTCTGGACTCTCGTTGCTAGCTTTCTG
TCGTTCGGAATCTGGTCTCTCATCGGCCTCACACATAATATTCGACTCGCACGAGCCACGAAGCTACCCTATGTG
ATCCTGCCGTACTCATTGCTCGGTGCGCCATGGCAGCTGACCCAGTGCGTTGTGGTCCCAGTTGCAAAGCTCATC
CCTAAACGACTGACCCGGGAATGGCTACCCCTACTCTTATTGAACGAGTTCTGGCACGATGGCTACGAGCCGTTC
GGACGAATCAAAGCCGATACCTTCCTGGCCGCCTCCCCAGGGGGACTCATTCTCTACACGTGCGATCCAGACGTC
AGCACCCAATTGTTTCGTGATGGGAACTTTGGCAAGCCGACCGAGCTGATGTCTGTACTGAACATTTATGGACCT
ACCATCACCGGCACCGATGGCCCAGAGTCTCGCCTCTACCGTAAACTCACGGGCCCGTTCTTCTCGGACAAGACT
TTGCGTCGCGTCTTTGTCAAGTCGGTTTCTGGAGCAAAGATACTCCTCGCCGCCCTGACGCGTCCAAACGCTCAT
CGCAAATTACGAACATTATCTGCGAGGCTTTCGCTCAACACGTTGAGCCAGATCTGTTTCAGAAATCAGACCGAC
TCCGATCTTGTCAAAGCATTGGCCTTCGAAGACGACATACCGAATGGGAGGACGCTGAGCTACAGCGAGGCCTTG
CATGGCCTGATAGATAACTGGAACGCGATATTCCTCGTGCCTCACTGGCTGTTGCGCCTGTCGCCGTTTCGGTCC
CACAATCATGCAGCCGAATGCTATACGGAGCTCGGGTCGTATATGGACCAACTCAAGAGGGAAAAGGAAGGCATG
CTCTCTGAGAATTCCATGCACAATACCCCGAACGATCCATGCACCCTTCTTGACCTTCTCGTACAGGCCGGTCTG
CCCTCTCCTGGCCAGGCCAACCCTTTATTGGCCAACGCCCAGGTCATCGGCCAAATTTTTCTCTTCATGTTCGCC
GGGCATGAAGCCAACGCCAACGTGGTGGTCTCCGTCATACTCCTGCTGGCATGCCACCCCCATGTCCAGGAAACG
ATGCAACGGGATCTTGACCGTGTTCTTGGCGAGAAATCCCCGGATACCTGGTCGTATGACGTGCATTACAGTGCG
CTCATGCAGACAACCGTCGGTGCGGTCATCAATGAGGCTCTCCGCCTCTTTAGCGTCATCCCCGTCCTGCCAAAA
TATGTCCCGCCTAGGAGCCCGTGGCCTTCTATCAGTGTTCAAGGCCAGCAGCATCTGCTGCCGCCGAACACCATC
GCCCTCATAAATACAAGTGCTACACATCGGCATCCGAGTTACTGGCCAAGGAGACTATCGAATACGGCTGAAGGC
GATCCTGCTTGGACAGACATAAGAAATGACCCCTGCCAGCGTCCATTCGCGGCGGCAGACTTTGATCCATCGAGA
TGGACGGAGATTGACAGCGCGGAGGACAACGACACGGCTTCAGGAGGGTTCCTAAAGCCCAGAGTCGGGACTTTC
ATCCCCTTCTCTGAAGGCAGTCGTGGATGCCTCGGGCGGCGATTTGCGCTGGTGGAGGTCTGCGCCGTGGTCTCG
ACGTTATTTAAGACGCACTCCGTGGCGCTCATATCCGGCCCTGGGGATGGTTCTGACGTGCGAGAAGCATGGTTG
GAGGCTCGCCGACGTGCCGCGCTCGCTCTGTCCGAGGGTACGGAGTTCGGCATGAGCTTGCGGATTGAAAGAAAT
GTACCTATCAAGTTTATACCAAGAGATCAAGAAGAAATGCCGACGTGCAGGTTCTAG
Transcript >Hirsu2|8828
ATGATCTTCGAGGCTTCCGCCACCATGAACCAGCTCGTGGCTTTCAGTTTCTGGACTCTCGTTGCTAGCTTTCTG
TCGTTCGGAATCTGGTCTCTCATCGGCCTCACACATAATATTCGACTCGCACGAGCCACGAAGCTACCCTATGTG
ATCCTGCCGTACTCATTGCTCGGTGCGCCATGGCAGCTGACCCAGTGCGTTGTGGTCCCAGTTGCAAAGCTCATC
CCTAAACGACTGACCCGGGAATGGCTACCCCTACTCTTATTGAACGAGTTCTGGCACGATGGCTACGAGCCGTTC
GGACGAATCAAAGCCGATACCTTCCTGGCCGCCTCCCCAGGGGGACTCATTCTCTACACGTGCGATCCAGACGTC
AGCACCCAATTGTTTCGTGATGGGAACTTTGGCAAGCCGACCGAGCTGATGTCTGTACTGAACATTTATGGACCT
ACCATCACCGGCACCGATGGCCCAGAGTCTCGCCTCTACCGTAAACTCACGGGCCCGTTCTTCTCGGACAAGACT
TTGCGTCGCGTCTTTGTCAAGTCGGTTTCTGGAGCAAAGATACTCCTCGCCGCCCTGACGCGTCCAAACGCTCAT
CGCAAATTACGAACATTATCTGCGAGGCTTTCGCTCAACACGTTGAGCCAGATCTGTTTCAGAAATCAGACCGAC
TCCGATCTTGTCAAAGCATTGGCCTTCGAAGACGACATACCGAATGGGAGGACGCTGAGCTACAGCGAGGCCTTG
CATGGCCTGATAGATAACTGGAACGCGATATTCCTCGTGCCTCACTGGCTGTTGCGCCTGTCGCCGTTTCGGTCC
CACAATCATGCAGCCGAATGCTATACGGAGCTCGGGTCGTATATGGACCAACTCAAGAGGGAAAAGGAAGGCATG
CTCTCTGAGAATTCCATGCACAATACCCCGAACGATCCATGCACCCTTCTTGACCTTCTCGTACAGGCCGGTCTG
CCCTCTCCTGGCCAGGCCAACCCTTTATTGGCCAACGCCCAGGTCATCGGCCAAATTTTTCTCTTCATGTTCGCC
GGGCATGAAGCCAACGCCAACGTGGTGGTCTCCGTCATACTCCTGCTGGCATGCCACCCCCATGTCCAGGAAACG
ATGCAACGGGATCTTGACCGTGTTCTTGGCGAGAAATCCCCGGATACCTGGTCGTATGACGTGCATTACAGTGCG
CTCATGCAGACAACCGTCGGTGCGGTCATCAATGAGGCTCTCCGCCTCTTTAGCGTCATCCCCGTCCTGCCAAAA
TATGTCCCGCCTAGGAGCCCGTGGCCTTCTATCAGTGTTCAAGGCCAGCAGCATCTGCTGCCGCCGAACACCATC
GCCCTCATAAATACAAGTGCTACACATCGGCATCCGAGTTACTGGCCAAGGAGACTATCGAATACGGCTGAAGGC
GATCCTGCTTGGACAGACATAAGAAATGACCCCTGCCAGCGTCCATTCGCGGCGGCAGACTTTGATCCATCGAGA
TGGACGGAGATTGACAGCGCGGAGGACAACGACACGGCTTCAGGAGGGTTCCTAAAGCCCAGAGTCGGGACTTTC
ATCCCCTTCTCTGAAGGCAGTCGTGGATGCCTCGGGCGGCGATTTGCGCTGGTGGAGGTCTGCGCCGTGGTCTCG
ACGTTATTTAAGACGCACTCCGTGGCGCTCATATCCGGCCCTGGGGATGGTTCTGACGTGCGAGAAGCATGGTTG
GAGGCTCGCCGACGTGCCGCGCTCGCTCTGTCCGAGGGTACGGAGTTCGGCATGAGCTTGCGGATTGAAAGAAAT
GTACCTATCAAGTTTATACCAAGAGATCAAGAAGAAATGCCGACGTGCAGGTTCTAG
Gene >Hirsu2|8828
ATGATCTTCGAGGCTTCCGCCACCATGAACCAGCTCGTGGCTTTCAGTTTCTGGACTCTCGTTGCTAGCTTTCTG
TCGTTCGGAATCTGGTCTCTCATCGGCCTCACACATAATATTCGACTCGCACGAGCCACGAAGCTACCCTATGTG
ATCCTGCCGTACTCATTGCTCGGTGCGCCATGGCAGCTGACCCAGTGCGTTGTGGTCCCAGTTGCAAAGCTCATC
CCTAAACGACTGACCCGGGAATGGCTACCCCTACTCTTATTGAACGAGTTCTGGCACGATGGCTACGAGCCGTTC
GGACGAATCAAAGCCGATACCTTCCTGGCCGCCTCCCCAGGGGGACTCATTCTCTACACGTGCGATCCAGACGTC
AGCACCCAATTGTTTCGTGATGGGAACTTTGGCAAGCCGACCGAGCTGATGTCTGTACTGAACATTTATGGACCT
ACCATCACCGGCACCGATGGCCCAGAGTCTCGCCTCTACCGTAAACTCACGGGCCCGTTCTTCTCGGACAAGACT
TTGCGTCGCGTCTTTGTCAAGTCGGTTTCTGGAGCAAAGATACTCCTCGCCGCCCTGACGCGTCCAAACGCTCAT
CGCAAATTACGAACATTATCTGCGAGGCTTTCGCTCAACACGTTGAGCCAGATCTGTTTCAGAAATCAGACCGAC
TCCGATCTTGTCAAAGCATTGGCCTTCGAAGACGACATACCGAATGGGAGGACGCTGAGCTACAGCGAGGCCTTG
CATGGCCTGATAGATAACTGGAACGCGATATTCCTCGTGCCTCACTGGCTGTTGCGCCTGTCGCCGTTTCGGTCC
CACAATCATGCAGCCGAATGCTATACGGAGCTCGGGTCGTATATGGACCAACTCAAGAGGGAAAAGGAAGGCATG
CTCTCTGAGAATTCCATGCACAATACCCCGAACGATCCATGCACCCTTCTTGACCTTCTCGTACAGGCCGGTCTG
CCCTCTCCTGGCCAGGCCAACCCTTTATTGGCCAACGCCCAGGTCATCGGCCAAATTTTTCTCTTCATGTTCGCC
GGGCATGAAGCCAACGCCAACGTGGTGGTCTCCGTCATACTCCTGCTGGCATGCCACCCCCATGTCCAGGAAACG
ATGCAACGGGATCTTGACCGTGTTCTTGGCGAGAAATCCCCGGATACCTGGTCGTATGACGTGCATTACAGTGCG
CTCATGCAGACAACCGTCGGTGCGGTCATCAATGAGGCTCTCCGCCTCTTTAGCGTCATCCCCGTCCTGCCAAAA
TATGTCCCGCCTAGGAGCCCGTGGCCTTCTATCAGTGTTCAAGGCCAGCAGCATCTGCTGCCGCCGAACACCATC
GCCCTCATAAATACAAGTGCTACACATCGGCATCCGAGTTACTGGCCAAGGAGACTATCGAATACGGCTGAAGGC
GATCCTGCTTGGACAGACATAAGAAATGACCCCTGCCAGCGTCCATTCGCGGCGGCAGACTTTGATCCATCGAGA
TGGACGGAGATTGACAGCGCGGAGGACAACGACACGGCTTCAGGAGGGTTCCTAAAGCCCAGAGTCGGGACTTTC
ATCCCCTTCTCTGAAGGCAGTCGTGGATGCCTCGGGCGGCGATTTGCGCTGGTGGAGGTCTGCGCCGTGGTCTCG
ACGTTATTTAAGACGCACTCCGTGGCGCTCATATCCGGCCCTGGGGATGGTTCTGACGTGCGAGAAGCATGGTTG
GAGGCTCGCCGACGTGCCGCGCTCGCTCTGTCCGAGGGTACGGAGTTCGGCATGAGCTTGCGGATTGAAAGAAAT
GTACCTATCAAGTTTATACCAAGAGATCAAGAAGAAATGCCGACGTGCAGGTTCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail