Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8827
Gene name
LocationContig_60:43364..44261
Strand-
Gene length (bp)897
Transcript length (bp)684
Coding sequence length (bp)684
Protein length (aa) 228

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain 1.6E-13 15 82
PF00043 GST_C Glutathione S-transferase, C-terminal domain 2.3E-12 113 210
PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain 9.4E-12 15 77
PF02798 GST_N Glutathione S-transferase, N-terminal domain 1.4E-10 7 77
PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain 3.7E-09 129 216

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59827|GST2_SCHPO Glutathione S-transferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gst2 PE=2 SV=1 8 219 4.0E-42
sp|Q9Y7Q2|GST1_SCHPO Glutathione S-transferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gst1 PE=2 SV=1 15 216 2.0E-38
sp|Q6BM74|URE2_DEBHA Protein URE2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=URE2 PE=3 SV=2 8 216 6.0E-31
sp|Q96WL3|URE2_CANAL Protein URE2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=URE2 PE=3 SV=1 8 216 1.0E-30
sp|Q8NJR0|URE2_CANMA Protein URE2 OS=Candida maltosa GN=URE2 PE=3 SV=1 8 216 3.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59827|GST2_SCHPO Glutathione S-transferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gst2 PE=2 SV=1 8 219 4.0E-42
sp|Q9Y7Q2|GST1_SCHPO Glutathione S-transferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gst1 PE=2 SV=1 15 216 2.0E-38
sp|Q6BM74|URE2_DEBHA Protein URE2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=URE2 PE=3 SV=2 8 216 6.0E-31
sp|Q96WL3|URE2_CANAL Protein URE2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=URE2 PE=3 SV=1 8 216 1.0E-30
sp|Q8NJR0|URE2_CANMA Protein URE2 OS=Candida maltosa GN=URE2 PE=3 SV=1 8 216 3.0E-30
sp|A5DDU4|URE2_PICGU Protein URE2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=URE2 PE=3 SV=2 8 216 3.0E-29
sp|Q8NJR6|URE2_SACBA Protein URE2 OS=Saccharomyces bayanus GN=URE2 PE=3 SV=1 3 216 6.0E-29
sp|Q96X43|URE2_KLULA Protein URE2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=URE2 PE=3 SV=1 8 216 1.0E-28
sp|Q8NJR4|URE2_KLUMA Protein URE2 OS=Kluyveromyces marxianus GN=URE2 PE=3 SV=1 8 216 2.0E-28
sp|Q8NJR5|URE2_CANGA Protein URE2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=URE2 PE=3 SV=2 8 216 3.0E-28
sp|P23202|URE2_YEAST Transcriptional regulator URE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URE2 PE=1 SV=1 3 216 5.0E-28
sp|Q7LLZ8|URE2_SACPA Protein URE2 OS=Saccharomyces paradoxus GN=URE2 PE=3 SV=1 3 216 6.0E-28
sp|Q8NJR2|URE2_ASHGO Protein URE2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=URE2 PE=3 SV=1 8 216 2.0E-25
sp|Q8SSU2|Y4223_DICDI Glutathione S-transferase domain-containing protein DDB_G0274223 OS=Dictyostelium discoideum GN=DDB_G0274223 PE=3 SV=1 8 215 3.0E-18
sp|Q54UR0|Y0881_DICDI Glutathione S-transferase domain-containing protein DDB_G0280881 OS=Dictyostelium discoideum GN=DDB_G0280881 PE=3 SV=1 8 215 2.0E-17
sp|Q555N6|Y4705_DICDI Glutathione S-transferase domain-containing protein DDB_G0274705 OS=Dictyostelium discoideum GN=DDB_G0274705 PE=3 SV=3 8 221 8.0E-16
sp|P77526|YFCG_ECOLI Disulfide-bond oxidoreductase YfcG OS=Escherichia coli (strain K12) GN=yfcG PE=1 SV=1 14 174 2.0E-14
sp|Q46845|YGHU_ECOLI Disulfide-bond oxidoreductase YghU OS=Escherichia coli (strain K12) GN=yghU PE=1 SV=2 5 214 3.0E-13
sp|O65857|GSTF1_ORYSJ Probable glutathione S-transferase GSTF1 OS=Oryza sativa subsp. japonica GN=GSTF1 PE=1 SV=2 3 219 1.0E-12
sp|Q9SRY5|GSTF7_ARATH Glutathione S-transferase F7 OS=Arabidopsis thaliana GN=GSTF7 PE=2 SV=3 6 216 1.0E-12
sp|O82451|GSTF2_ORYSJ Probable glutathione S-transferase GSTF2 OS=Oryza sativa subsp. japonica GN=GSTF2 PE=1 SV=3 3 220 2.0E-12
sp|P04907|GSTF3_MAIZE Glutathione S-transferase 3 OS=Zea mays GN=GST3 PE=1 SV=4 3 219 8.0E-12
sp|P42760|GSTF6_ARATH Glutathione S-transferase F6 OS=Arabidopsis thaliana GN=GSTF6 PE=2 SV=2 6 216 3.0E-11
sp|Q96266|GSTF8_ARATH Glutathione S-transferase F8, chloroplastic OS=Arabidopsis thaliana GN=GSTF8 PE=1 SV=3 19 169 9.0E-11
sp|Q04522|GSTF_SILVU Glutathione S-transferase OS=Silene vulgaris GN=GST PE=1 SV=3 6 218 1.0E-10
sp|P30110|GSTF1_WHEAT Glutathione S-transferase 1 OS=Triticum aestivum GN=GSTA1 PE=2 SV=1 3 215 3.0E-09
sp|Q9SLM6|GSTF3_ARATH Glutathione S-transferase F3 OS=Arabidopsis thaliana GN=GSTF3 PE=2 SV=1 6 216 4.0E-08
sp|P46422|GSTF2_ARATH Glutathione S-transferase F2 OS=Arabidopsis thaliana GN=GSTF2 PE=1 SV=3 6 215 6.0E-08
sp|Q96324|GSTFB_ARATH Glutathione S-transferase F11 OS=Arabidopsis thaliana GN=GSTF11 PE=2 SV=1 6 191 8.0E-08
sp|O80852|GSTF9_ARATH Glutathione S-transferase F9 OS=Arabidopsis thaliana GN=GSTF9 PE=1 SV=1 16 217 9.0E-08
sp|P0ACA8|GSTB_ECOL6 Glutathione S-transferase GstB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gstB PE=3 SV=1 6 218 1.0E-07
sp|P0ACA7|GSTB_ECOLI Glutathione S-transferase GstB OS=Escherichia coli (strain K12) GN=gstB PE=1 SV=1 6 218 1.0E-07
sp|P0ACA9|GSTB_SHIFL Glutathione S-transferase GstB OS=Shigella flexneri GN=gstB PE=3 SV=1 6 218 1.0E-07
sp|Q8DTN7|Y1296_STRMU Uncharacterized GST-like protein SMU_1296 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=SMU_1296 PE=3 SV=1 4 218 2.0E-07
sp|P21161|DCMA_METED Dichloromethane dehalogenase OS=Methylobacterium extorquens (strain DSM 5838 / DM4) GN=dcmA PE=1 SV=1 23 215 4.0E-07
sp|P30109|GSTF1_TOBAC Glutathione S-transferase PARB OS=Nicotiana tabacum GN=PARB PE=2 SV=1 42 209 1.0E-06
sp|Q9FE46|GSTFC_ARATH Glutathione S-transferase F12 OS=Arabidopsis thaliana GN=GSTF12 PE=1 SV=1 6 170 1.0E-06
sp|Q9ZRI7|EF1G1_ORYSJ Elongation factor 1-gamma 1 OS=Oryza sativa subsp. japonica GN=Os02g0220600 PE=2 SV=1 42 216 2.0E-06
sp|Q9VG98|GSTD2_DROME Glutathione S-transferase D2 OS=Drosophila melanogaster GN=GstD2 PE=1 SV=1 20 170 3.0E-06
sp|O76483|GSTT7_ANOGA Glutathione S-transferase D7 OS=Anopheles gambiae GN=GstD7 PE=2 SV=1 8 206 3.0E-06
sp|P42761|GSTFA_ARATH Glutathione S-transferase F10 OS=Arabidopsis thaliana GN=GSTF10 PE=1 SV=3 19 215 5.0E-06
sp|P46440|GSTF2_TOBAC Glutathione S-transferase APIC OS=Nicotiana tabacum GN=APIC PE=2 SV=1 42 209 7.0E-06
sp|Q9FUM1|EF1G_PRUAV Elongation factor 1-gamma OS=Prunus avium PE=2 SV=1 16 223 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8827
MTLKPIKLYWRNQVPNPSKVLIILEELNLPYESSWVELDGLKQKPYTDVNPNGRVPAIVDPNHNVTLWESGAIVQ
YLIDTYDKDNKISYSSFPDKYLTQQWSYYQASGQGPYFGQAAWFNLFHEKVYGESPESAKVRYGAEVKRVAGVLD
GVLAKSEWLVGDKCTYADLAFTMWNAQIAFFMGSRTGEHAWNPDEFPHFTKWQNACLSRDSVKKVLSVLNDKEVK
SS*
Coding >Hirsu2|8827
ATGACTCTCAAGCCGATCAAACTGTACTGGAGGAACCAGGTTCCCAACCCGTCCAAGGTCCTCATCATACTTGAA
GAGCTCAACCTGCCTTACGAGTCCTCCTGGGTCGAGCTTGATGGCCTCAAGCAGAAGCCCTATACCGATGTCAAC
CCAAATGGCCGTGTTCCAGCCATTGTGGACCCGAACCACAACGTCACGCTTTGGGAGTCTGGCGCCATCGTCCAG
TATCTAATCGATACATATGACAAGGACAACAAGATATCCTACAGCAGCTTCCCCGACAAGTACTTGACTCAGCAG
TGGTCATACTACCAAGCCTCTGGCCAAGGCCCCTACTTCGGTCAAGCTGCCTGGTTCAACCTCTTCCACGAAAAA
GTGTACGGCGAGTCCCCAGAGTCAGCCAAAGTTCGCTACGGCGCCGAGGTCAAGCGTGTGGCTGGCGTTCTCGAC
GGCGTGCTGGCCAAGTCAGAGTGGCTTGTAGGCGACAAATGCACCTACGCTGATCTGGCCTTCACCATGTGGAAC
GCGCAGATTGCTTTCTTCATGGGCAGCCGCACTGGCGAGCACGCTTGGAACCCTGACGAGTTCCCGCATTTCACC
AAGTGGCAGAATGCTTGCTTGAGCCGTGACAGCGTCAAGAAGGTCCTGAGCGTTCTCAACGATAAGGAGGTCAAG
AGCAGCTGA
Transcript >Hirsu2|8827
ATGACTCTCAAGCCGATCAAACTGTACTGGAGGAACCAGGTTCCCAACCCGTCCAAGGTCCTCATCATACTTGAA
GAGCTCAACCTGCCTTACGAGTCCTCCTGGGTCGAGCTTGATGGCCTCAAGCAGAAGCCCTATACCGATGTCAAC
CCAAATGGCCGTGTTCCAGCCATTGTGGACCCGAACCACAACGTCACGCTTTGGGAGTCTGGCGCCATCGTCCAG
TATCTAATCGATACATATGACAAGGACAACAAGATATCCTACAGCAGCTTCCCCGACAAGTACTTGACTCAGCAG
TGGTCATACTACCAAGCCTCTGGCCAAGGCCCCTACTTCGGTCAAGCTGCCTGGTTCAACCTCTTCCACGAAAAA
GTGTACGGCGAGTCCCCAGAGTCAGCCAAAGTTCGCTACGGCGCCGAGGTCAAGCGTGTGGCTGGCGTTCTCGAC
GGCGTGCTGGCCAAGTCAGAGTGGCTTGTAGGCGACAAATGCACCTACGCTGATCTGGCCTTCACCATGTGGAAC
GCGCAGATTGCTTTCTTCATGGGCAGCCGCACTGGCGAGCACGCTTGGAACCCTGACGAGTTCCCGCATTTCACC
AAGTGGCAGAATGCTTGCTTGAGCCGTGACAGCGTCAAGAAGGTCCTGAGCGTTCTCAACGATAAGGAGGTCAAG
AGCAGCTGA
Gene >Hirsu2|8827
ATGACTCTCAAGCCGATCAAACTGTACTGGAGGAGTGAGCATAACAGTCCGGTGCTTTAGCTCTGGATCCGTCGC
TGACACCAAACTGGACGTTCACAGACCAGGTTCCCAACCCGTCCAAGGTCCTCATCATACTTGAAGAGCTCAACC
TGCCTTACGAGTCCTCCTGGGTCGAGCTTGATGGCCTCAAGCAGAAGCCCTATACCGATGTCAACCCAAATGGCC
GTGTTCCAGCCATTGTGGACCCGAACCACAACGTCACGCTTTGGGAGTCTGGCGCCATCGTCCAGGTGAGCCCCA
CCACGAGGGAGATCAAATCGCCGCCGTTTTGAATCAAGCTTACATGTACTCCTACAACTAGTATCTAATCGATAC
ATATGACAAGGACAACAAGATATCCTACAGCAGCTTCCCCGACAAGTACTTGACTCAGCAGTGGTCATACTACCA
AGCCTCTGGCCAAGGCCCCTACTTCGGTCAAGCTGCCTGGTGAGCCCTTTCATGCCGTTCCCCCATATAATTTTG
CACATCCCGGCCGTGGTCGAATTCTCATCATTCCTGCGCAGGTTCAACCTCTTCCACGAAAAAGTGTACGGCGAG
TCCCCAGAGTCAGCCAAAGTTCGCTACGGCGCCGAGGTCAAGCGTGTGGCTGGCGTTCTCGACGGCGTGCTGGCC
AAGTCAGAGTGGCTTGTAGGCGACAAATGCACCTACGCTGATCTGGCCTTCACCATGTGGAACGCGCAGATTGCT
TTCTTCATGGGCAGCCGCACTGGCGAGCACGCTTGGAACCCTGACGAGTTCCCGCATTTCACCAAGTGGCAGAAT
GCTTGCTTGAGCCGTGACAGCGTCAAGAAGGTCCTGAGCGTTCTCAACGATAAGGAGGTCAAGAGCAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail