© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|8824 |
| Gene name | |
| Location | Contig_60:36291..37874 |
| Strand | - |
| Gene length (bp) | 1583 |
| Transcript length (bp) | 1524 |
| Coding sequence length (bp) | 1524 |
| Protein length (aa) | 508 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00067 | p450 | Cytochrome P450 | 1.3E-56 | 42 | 474 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q12609|STCF_EMENI | Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 | 25 | 495 | 4.0E-95 |
| sp|Q12732|AVNA_ASPPA | Averantin hydroxylase OS=Aspergillus parasiticus GN=avnA PE=1 SV=2 | 22 | 494 | 2.0E-90 |
| sp|Q00707|STCL_EMENI | Versicolorin B desaturase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcL PE=1 SV=2 | 15 | 493 | 6.0E-83 |
| sp|O13317|TRI11_FUSSP | Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 | 13 | 493 | 1.0E-81 |
| sp|Q9UW95|AFLL_ASPPA | Versicolorin B desaturase OS=Aspergillus parasiticus GN=verB PE=3 SV=1 | 11 | 498 | 5.0E-78 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q12609|STCF_EMENI | Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 | 25 | 495 | 4.0E-95 |
| sp|Q12732|AVNA_ASPPA | Averantin hydroxylase OS=Aspergillus parasiticus GN=avnA PE=1 SV=2 | 22 | 494 | 2.0E-90 |
| sp|Q00707|STCL_EMENI | Versicolorin B desaturase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcL PE=1 SV=2 | 15 | 493 | 6.0E-83 |
| sp|O13317|TRI11_FUSSP | Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 | 13 | 493 | 1.0E-81 |
| sp|Q9UW95|AFLL_ASPPA | Versicolorin B desaturase OS=Aspergillus parasiticus GN=verB PE=3 SV=1 | 11 | 498 | 5.0E-78 |
| sp|Q4WAW5|FTMC_ASPFU | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 | 10 | 472 | 3.0E-55 |
| sp|B9WZX1|FTMC_ASPFM | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 | 10 | 472 | 3.0E-55 |
| sp|A1DA60|FTMC_NEOFI | Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 | 4 | 472 | 9.0E-55 |
| sp|O00061|CP67_UROFA | Cytochrome P450 67 (Fragment) OS=Uromyces fabae GN=CYP67 PE=2 SV=1 | 22 | 473 | 3.0E-45 |
| sp|P17549|CP53_ASPNG | Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 | 32 | 463 | 2.0E-35 |
| sp|Q12612|TRI4_FUSSP | Trichodiene oxygenase OS=Fusarium sporotrichioides GN=TRI4 PE=3 SV=1 | 16 | 463 | 8.0E-32 |
| sp|Q12645|PID9_FUSSO | Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 | 16 | 480 | 2.0E-31 |
| sp|P38364|PID6_FUSSO | Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 | 16 | 480 | 2.0E-30 |
| sp|Q12608|STCB_EMENI | Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 | 28 | 453 | 2.0E-28 |
| sp|P08684|CP3A4_HUMAN | Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 | 105 | 500 | 2.0E-24 |
| sp|P24462|CP3A7_HUMAN | Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 | 111 | 500 | 4.0E-24 |
| sp|P11707|CP3A6_RABIT | Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 | 114 | 500 | 4.0E-24 |
| sp|Q98T91|C340_ORYLA | Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 | 123 | 498 | 5.0E-24 |
| sp|O18993|CP3AL_CALJA | Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 | 105 | 500 | 6.0E-24 |
| sp|P24463|CP3AC_CANLF | Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 | 105 | 500 | 7.0E-24 |
| sp|Q64148|CP3AA_MESAU | Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 | 105 | 462 | 9.0E-24 |
| sp|O35132|CP27B_RAT | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 | 179 | 471 | 3.0E-23 |
| sp|P51538|CP3A9_RAT | Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 | 62 | 500 | 6.0E-23 |
| sp|Q29496|CP3AO_SHEEP | Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 | 106 | 500 | 8.0E-23 |
| sp|O15528|CP27B_HUMAN | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 | 179 | 466 | 8.0E-23 |
| sp|Q64581|CP3AI_RAT | Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 | 105 | 493 | 2.0E-22 |
| sp|P20815|CP3A5_HUMAN | Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 | 79 | 459 | 7.0E-22 |
| sp|Q64464|CP3AD_MOUSE | Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 | 14 | 471 | 1.0E-21 |
| sp|Q8K4D6|CP4X1_RAT | Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 | 123 | 466 | 1.0E-21 |
| sp|O35084|CP27B_MOUSE | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 | 179 | 471 | 1.0E-21 |
| sp|O64636|C76C1_ARATH | Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 | 45 | 467 | 2.0E-21 |
| sp|O09158|CP3AP_MOUSE | Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 | 105 | 500 | 6.0E-21 |
| sp|Q9PVE8|C330_FUNHE | Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 | 123 | 494 | 9.0E-21 |
| sp|Q8AXY5|C356_FUNHE | Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 | 123 | 494 | 9.0E-21 |
| sp|Q9V7G5|C4AA1_DROME | Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2 | 113 | 477 | 1.0E-20 |
| sp|P04800|CP3A1_RAT | Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 | 105 | 459 | 2.0E-20 |
| sp|Q9HB55|CP343_HUMAN | Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 | 14 | 476 | 3.0E-20 |
| sp|P33268|CP3A8_MACFA | Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 | 111 | 500 | 8.0E-20 |
| sp|Q64481|CP3AG_MOUSE | Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 | 105 | 500 | 8.0E-20 |
| sp|P05183|CP3A2_RAT | Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 | 105 | 500 | 9.0E-20 |
| sp|Q6A152|CP4X1_MOUSE | Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 | 123 | 466 | 1.0E-19 |
| sp|Q64459|CP3AB_MOUSE | Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 | 79 | 500 | 2.0E-19 |
| sp|O42563|CP3AR_ONCMY | Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 | 123 | 493 | 2.0E-19 |
| sp|Q9VLZ7|C4D21_DROME | Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 | 110 | 469 | 2.0E-19 |
| sp|P79401|CP3AT_PIG | Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 | 14 | 500 | 2.0E-19 |
| sp|O64635|C76C4_ARATH | Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 | 132 | 467 | 4.0E-19 |
| sp|O48923|C71DA_SOYBN | Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 | 53 | 464 | 5.0E-19 |
| sp|O16805|CP4D1_DROSI | Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 | 100 | 462 | 5.0E-19 |
| sp|P33269|CP4D1_DROME | Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 | 100 | 461 | 5.0E-19 |
| sp|P17178|CP27A_RAT | Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 | 121 | 467 | 8.0E-19 |
| sp|O70537|CP3AV_MESAU | Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 | 105 | 500 | 1.0E-18 |
| sp|Q9LUC8|C7A13_ARATH | Cytochrome P450 72A13 OS=Arabidopsis thaliana GN=CYP72A13 PE=2 SV=1 | 79 | 465 | 1.0E-18 |
| sp|Q9W011|C4D20_DROME | Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 | 113 | 469 | 2.0E-18 |
| sp|O48786|C734A_ARATH | Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 | 79 | 465 | 2.0E-18 |
| sp|Q8N118|CP4X1_HUMAN | Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2 SV=1 | 123 | 465 | 3.0E-18 |
| sp|O64637|C76C2_ARATH | Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 | 55 | 467 | 4.0E-18 |
| sp|Q09128|CP24A_RAT | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 | 21 | 461 | 5.0E-18 |
| sp|Q9JMA7|CP341_MOUSE | Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 | 105 | 459 | 6.0E-18 |
| sp|P37122|C76A2_SOLME | Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 | 123 | 467 | 7.0E-18 |
| sp|Q64406|CP3AF_CAVPO | Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 | 105 | 500 | 9.0E-18 |
| sp|Q02318|CP27A_HUMAN | Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 | 125 | 465 | 9.0E-18 |
| sp|Q3MID2|CP4F3_RAT | Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 | 61 | 461 | 9.0E-18 |
| sp|P98187|CP4F8_HUMAN | Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 | 125 | 461 | 1.0E-17 |
| sp|Q64417|CP3AE_CAVPO | Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 | 114 | 459 | 1.0E-17 |
| sp|O22307|C71DB_LOTJA | Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1 | 152 | 467 | 2.0E-17 |
| sp|Q9DBW0|CP4V2_MOUSE | Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 | 113 | 459 | 2.0E-17 |
| sp|Q9VE01|C12A5_DROME | Probable cytochrome P450 12a5, mitochondrial OS=Drosophila melanogaster GN=Cyp12a5 PE=2 SV=1 | 260 | 461 | 4.0E-17 |
| sp|Q6ZWL3|CP4V2_HUMAN | Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 | 125 | 459 | 5.0E-17 |
| sp|A2RRT9|CP4V2_RAT | Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 | 113 | 459 | 7.0E-17 |
| sp|Q64409|CP3AH_CAVPO | Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 | 105 | 500 | 7.0E-17 |
| sp|Q9VVR9|C12C1_DROME | Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 | 31 | 470 | 1.0E-16 |
| sp|P15128|CP4B1_RABIT | Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 | 125 | 471 | 1.0E-16 |
| sp|O46051|C4D14_DROME | Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 | 123 | 461 | 1.0E-16 |
| sp|P15129|CP4B1_RAT | Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 | 125 | 465 | 1.0E-16 |
| sp|P58049|C71BB_ARATH | Cytochrome P450 71B11 OS=Arabidopsis thaliana GN=CYP71B11 PE=2 SV=1 | 10 | 469 | 1.0E-16 |
| sp|O49396|C82C3_ARATH | Cytochrome P450 82C3 OS=Arabidopsis thaliana GN=CYP82C3 PE=2 SV=3 | 250 | 471 | 2.0E-16 |
| sp|Q9Y6A2|CP46A_HUMAN | Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP46A1 PE=1 SV=1 | 116 | 477 | 2.0E-16 |
| sp|Q99N16|CP4F3_MOUSE | Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 | 61 | 461 | 2.0E-16 |
| sp|Q8LIF2|C7345_ORYSJ | Cytochrome P450 734A5 OS=Oryza sativa subsp. japonica GN=CYP734A5 PE=2 SV=1 | 122 | 466 | 3.0E-16 |
| sp|O04164|C71A6_NEPRA | Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 | 170 | 467 | 3.0E-16 |
| sp|O65782|C83B1_ARATH | Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 | 265 | 467 | 4.0E-16 |
| sp|Q64462|CP4B1_MOUSE | Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 | 125 | 465 | 4.0E-16 |
| sp|A3A871|C71Z6_ORYSJ | Ent-isokaurene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z6 PE=1 SV=1 | 170 | 467 | 4.0E-16 |
| sp|Q5RCN6|CP4V2_PONAB | Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 | 125 | 459 | 4.0E-16 |
| sp|Q9VXY0|CP4S3_DROME | Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1 | 54 | 459 | 4.0E-16 |
| sp|P17177|CP27A_RABIT | Sterol 26-hydroxylase, mitochondrial OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1 | 44 | 465 | 4.0E-16 |
| sp|P51870|CP4F5_RAT | Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 | 122 | 461 | 5.0E-16 |
| sp|L7X3S1|MSH_PAPSO | Methyltetrahydroprotoberberine 14-monooxygenase OS=Papaver somniferum GN=CYP82N4 PE=1 SV=1 | 175 | 462 | 5.0E-16 |
| sp|Q6VVX0|CP2R1_HUMAN | Vitamin D 25-hydroxylase OS=Homo sapiens GN=CYP2R1 PE=1 SV=1 | 267 | 464 | 5.0E-16 |
| sp|Q9CX98|CP2U1_MOUSE | Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 | 294 | 471 | 5.0E-16 |
| sp|O46054|C4AE1_DROME | Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 | 124 | 469 | 6.0E-16 |
| sp|P49264|C71B1_THLAR | Cytochrome P450 71B1 OS=Thlaspi arvense GN=CYP71B1 PE=2 SV=1 | 250 | 467 | 7.0E-16 |
| sp|P79102|CP3AS_BOVIN | Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 | 123 | 459 | 8.0E-16 |
| sp|Q9XHE8|C71DI_MENSP | Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1 | 296 | 467 | 9.0E-16 |
| sp|Q6WKZ1|C71DI_MENGR | Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1 | 296 | 467 | 9.0E-16 |
| sp|P58050|C71BD_ARATH | Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1 | 250 | 469 | 1.0E-15 |
| sp|Q27589|CP4D2_DROME | Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 | 121 | 461 | 1.0E-15 |
| sp|P58051|C71BE_ARATH | Cytochrome P450 71B14 OS=Arabidopsis thaliana GN=CYP71B14 PE=2 SV=1 | 63 | 469 | 1.0E-15 |
| sp|Q64441|CP24A_MOUSE | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 | 21 | 461 | 2.0E-15 |
| sp|Q9WVK8|CP46A_MOUSE | Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp46a1 PE=1 SV=1 | 117 | 477 | 2.0E-15 |
| sp|P13584|CP4B1_HUMAN | Cytochrome P450 4B1 OS=Homo sapiens GN=CYP4B1 PE=1 SV=2 | 125 | 465 | 2.0E-15 |
| sp|Q2XV99|CP11A_MACFA | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Macaca fascicularis GN=CYP11A1 PE=2 SV=1 | 92 | 463 | 2.0E-15 |
| sp|P82712|CCD1P_DROME | Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 | 42 | 461 | 2.0E-15 |
| sp|Q43255|C71C2_MAIZE | indolin-2-one monooxygenase OS=Zea mays GN=CYP71C2 PE=1 SV=1 | 248 | 464 | 2.0E-15 |
| sp|Q6QNI4|C71AJ_AMMMJ | Psoralen synthase OS=Ammi majus GN=CYP71AJ1 PE=1 SV=1 | 260 | 466 | 3.0E-15 |
| sp|Q82IY3|PTLI_STRAW | Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 | 101 | 469 | 3.0E-15 |
| sp|P29981|CP4C1_BLADI | Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 | 125 | 461 | 3.0E-15 |
| sp|Q7KR10|CCD1D_DROME | Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 | 42 | 461 | 4.0E-15 |
| sp|Q8HYN1|CP17A_PANTR | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Pan troglodytes GN=CYP17A1 PE=2 SV=1 | 294 | 473 | 4.0E-15 |
| sp|Q9LIP5|C71BW_ARATH | Cytochrome P450 71B35 OS=Arabidopsis thaliana GN=CYP71B35 PE=2 SV=1 | 7 | 469 | 4.0E-15 |
| sp|P05093|CP17A_HUMAN | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Homo sapiens GN=CYP17A1 PE=1 SV=1 | 294 | 473 | 4.0E-15 |
| sp|Q6WKZ0|C7D94_MENGR | Cytochrome P450 71D94 OS=Mentha gracilis GN=CYP71D94 PE=2 SV=1 | 248 | 467 | 4.0E-15 |
| sp|C0SJS4|C71AJ_APIGR | Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 | 144 | 466 | 5.0E-15 |
| sp|P30437|CP17A_ONCMY | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oncorhynchus mykiss GN=cyp17a1 PE=2 SV=1 | 137 | 473 | 5.0E-15 |
| sp|Q8HYM9|CP17A_MACMU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca mulatta GN=CYP17A1 PE=2 SV=1 | 294 | 500 | 6.0E-15 |
| sp|Q2XVA1|CP17A_MACFA | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca fascicularis GN=CYP17A1 PE=2 SV=1 | 294 | 500 | 6.0E-15 |
| sp|Q8HYN0|CP17A_PAPCY | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio cynocephalus GN=CYP17A1 PE=2 SV=1 | 294 | 500 | 6.0E-15 |
| sp|Q9SZ46|C82C4_ARATH | Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 | 170 | 471 | 6.0E-15 |
| sp|Q50EK4|C75A1_PINTA | Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 | 238 | 460 | 6.0E-15 |
| sp|Q6TBX7|LUT1_ARATH | Carotene epsilon-monooxygenase, chloroplastic OS=Arabidopsis thaliana GN=CYP97C1 PE=1 SV=1 | 67 | 465 | 6.0E-15 |
| sp|Q6Z6D6|C7342_ORYSJ | Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 | 79 | 465 | 6.0E-15 |
| sp|P52786|CP2J1_RABIT | Cytochrome P450 2J1 OS=Oryctolagus cuniculus GN=CYP2J1 PE=1 SV=2 | 155 | 464 | 7.0E-15 |
| sp|Q95078|CP18A_DROME | Cytochrome P450 18a1 OS=Drosophila melanogaster GN=Cyp18a1 PE=2 SV=2 | 285 | 470 | 7.0E-15 |
| sp|Q4G0S4|C27C1_HUMAN | Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=2 | 148 | 462 | 8.0E-15 |
| sp|O49394|C82C2_ARATH | Cytochrome P450 82C2 OS=Arabidopsis thaliana GN=CYP82C2 PE=2 SV=2 | 250 | 471 | 9.0E-15 |
| sp|Q42716|C71A8_MENPI | Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 | 276 | 464 | 9.0E-15 |
| sp|Q9HBI6|CP4FB_HUMAN | Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 | 122 | 461 | 9.0E-15 |
| sp|Q9VE00|C12A4_DROME | Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 | 284 | 462 | 9.0E-15 |
| sp|P47195|C80A1_BERST | Berbamunine synthase OS=Berberis stolonifera GN=CYP80A1 PE=1 SV=1 | 125 | 467 | 1.0E-14 |
| sp|Q9LUC9|C7A11_ARATH | Cytochrome P450 72A11 OS=Arabidopsis thaliana GN=CYP72A11 PE=2 SV=1 | 79 | 465 | 1.0E-14 |
| sp|Q9LIP3|C71BY_ARATH | Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=CYP71B37 PE=3 SV=2 | 125 | 467 | 1.0E-14 |
| sp|P90771|C36A1_CAEEL | Probable cytochrome P450 CYP36A1 OS=Caenorhabditis elegans GN=cyp-36A1 PE=3 SV=2 | 271 | 460 | 1.0E-14 |
| sp|P20853|CP2A7_HUMAN | Cytochrome P450 2A7 OS=Homo sapiens GN=CYP2A7 PE=2 SV=2 | 155 | 459 | 1.0E-14 |
| sp|P51589|CP2J2_HUMAN | Cytochrome P450 2J2 OS=Homo sapiens GN=CYP2J2 PE=1 SV=2 | 155 | 469 | 1.0E-14 |
| sp|Q07973|CP24A_HUMAN | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 | 36 | 462 | 1.0E-14 |
| sp|P12394|CP17A_CHICK | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Gallus gallus GN=CYP17A1 PE=2 SV=1 | 182 | 473 | 1.0E-14 |
| sp|Q6YTF1|C76M8_ORYSJ | Oryzalexin D synthase OS=Oryza sativa subsp. japonica GN=CYP76M8 PE=1 SV=1 | 297 | 474 | 2.0E-14 |
| sp|P79153|CP11A_CAPHI | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Capra hircus GN=CYP11A1 PE=2 SV=1 | 142 | 463 | 2.0E-14 |
| sp|Q9XHC6|C93E1_SOYBN | Beta-amyrin 24-hydroxylase OS=Glycine max GN=CYP93E1 PE=1 SV=1 | 240 | 466 | 2.0E-14 |
| sp|Q69X58|C76M7_ORYSJ | Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 | 265 | 474 | 2.0E-14 |
| sp|Q05047|C72A1_CATRO | Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 | 122 | 465 | 2.0E-14 |
| sp|Q92113|CP17A_SQUAC | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 | 137 | 466 | 2.0E-14 |
| sp|P70687|CP17A_MESAU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mesocricetus auratus GN=CYP17A1 PE=2 SV=1 | 141 | 464 | 2.0E-14 |
| sp|Q9VMS8|C4AC2_DROME | Probable cytochrome P450 4ac2 OS=Drosophila melanogaster GN=Cyp4ac2 PE=2 SV=4 | 288 | 496 | 2.0E-14 |
| sp|Q964T1|CP4CU_BLAGE | Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 | 110 | 456 | 2.0E-14 |
| sp|F4JW83|C84A4_ARATH | Cytochrome P450 84A4 OS=Arabidopsis thaliana GN=CYP84A4 PE=1 SV=1 | 251 | 468 | 2.0E-14 |
| sp|P47787|THAS_PIG | Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 | 125 | 493 | 2.0E-14 |
| sp|Q91Z85|CP17A_PERLE | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Peromyscus leucopus GN=Cyp17a1 PE=3 SV=1 | 296 | 470 | 2.0E-14 |
| sp|Q43250|C71C1_MAIZE | 3-hydroxyindolin-2-one monooxygenase OS=Zea mays GN=CYP71C1 PE=1 SV=1 | 248 | 464 | 3.0E-14 |
| sp|D5JBX0|GAO_HELAN | Germacrene A oxidase OS=Helianthus annuus PE=1 SV=1 | 19 | 466 | 3.0E-14 |
| sp|P78329|CP4F2_HUMAN | Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 | 68 | 461 | 3.0E-14 |
| sp|Q8VWZ7|C76B6_CATRO | Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 | 184 | 477 | 3.0E-14 |
| sp|Q42798|C93A1_SOYBN | 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 | 247 | 459 | 3.0E-14 |
| sp|P14579|CP4A5_RABIT | Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 | 123 | 461 | 4.0E-14 |
| sp|P11509|CP2A6_HUMAN | Cytochrome P450 2A6 OS=Homo sapiens GN=CYP2A6 PE=1 SV=3 | 155 | 459 | 4.0E-14 |
| sp|Q9VS79|CP4D8_DROME | Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 | 121 | 466 | 4.0E-14 |
| sp|Q9LVD2|C71BA_ARATH | Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=CYP71B10 PE=3 SV=1 | 132 | 467 | 4.0E-14 |
| sp|Q9LUC6|C7A14_ARATH | Cytochrome P450 72A14 OS=Arabidopsis thaliana GN=CYP72A14 PE=2 SV=1 | 79 | 465 | 4.0E-14 |
| sp|Q08477|CP4F3_HUMAN | Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 | 122 | 461 | 4.0E-14 |
| sp|Q27712|CP2L1_PANAR | Cytochrome P450 2L1 OS=Panulirus argus GN=CYP2L1 PE=1 SV=1 | 270 | 466 | 5.0E-14 |
| sp|O81970|C71A9_SOYBN | Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 | 259 | 469 | 5.0E-14 |
| sp|Q6VVW9|CP2R1_MOUSE | Vitamin D 25-hydroxylase OS=Mus musculus GN=Cyp2r1 PE=2 SV=1 | 267 | 464 | 5.0E-14 |
| sp|Q9GLD2|CP17A_PAPHU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio hamadryas ursinus GN=CYP17A1 PE=1 SV=1 | 294 | 500 | 6.0E-14 |
| sp|Q93VK5|LUT5_ARATH | Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 | 68 | 466 | 6.0E-14 |
| sp|Q64410|CP17A_CAVPO | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Cavia porcellus GN=CYP17A1 PE=1 SV=1 | 223 | 473 | 6.0E-14 |
| sp|Q9DBG1|CP27A_MOUSE | Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 | 294 | 467 | 6.0E-14 |
| sp|Q9ZU07|C71BC_ARATH | Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1 | 294 | 469 | 6.0E-14 |
| sp|Q42799|C93A2_SOYBN | Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 | 247 | 460 | 6.0E-14 |
| sp|Q9LUC5|C7A15_ARATH | Cytochrome P450 72A15 OS=Arabidopsis thaliana GN=CYP72A15 PE=2 SV=1 | 79 | 465 | 6.0E-14 |
| sp|O81972|C82A2_SOYBN | Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1 | 123 | 464 | 7.0E-14 |
| sp|Q9XHE6|C71DF_MENPI | Cytochrome P450 71D15 OS=Mentha piperita GN=CYP71D15 PE=1 SV=1 | 3 | 467 | 7.0E-14 |
| sp|Q9LTM7|C71BG_ARATH | Cytochrome P450 71B16 OS=Arabidopsis thaliana GN=CYP71B16 PE=3 SV=1 | 248 | 467 | 7.0E-14 |
| sp|Q9VGZ0|C12E1_DROME | Probable cytochrome P450 12e1, mitochondrial OS=Drosophila melanogaster GN=Cyp12e1 PE=2 SV=4 | 284 | 480 | 7.0E-14 |
| sp|O49342|C71AD_ARATH | Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 | 253 | 470 | 7.0E-14 |
| sp|P03940|CP21A_MOUSE | Steroid 21-hydroxylase OS=Mus musculus GN=Cyp21 PE=2 SV=3 | 148 | 475 | 7.0E-14 |
| sp|P08682|CP2E1_RABIT | Cytochrome P450 2E1 OS=Oryctolagus cuniculus GN=CYP2E1 PE=2 SV=2 | 181 | 468 | 8.0E-14 |
| sp|Q9V5L3|C49A1_DROME | Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 | 29 | 466 | 8.0E-14 |
| sp|P70085|CP17A_ORYLA | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzias latipes GN=cyp17a1 PE=2 SV=1 | 137 | 475 | 8.0E-14 |
| sp|Q9VMT5|C28D1_DROME | Probable cytochrome P450 28d1 OS=Drosophila melanogaster GN=Cyp28d1 PE=2 SV=1 | 48 | 465 | 8.0E-14 |
| sp|H1A988|C7254_GLYUR | 11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1 | 83 | 465 | 8.0E-14 |
| sp|P9WPP9|CP51_MYCTU | Lanosterol 14-alpha demethylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp51 PE=1 SV=1 | 253 | 495 | 9.0E-14 |
| sp|P9WPP8|CP51_MYCTO | Lanosterol 14-alpha demethylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp51 PE=3 SV=1 | 253 | 495 | 9.0E-14 |
| sp|P0A513|CP51_MYCBO | Lanosterol 14-alpha demethylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp51 PE=3 SV=1 | 253 | 495 | 9.0E-14 |
| sp|Q05556|CP2AB_RABIT | Cytochrome P450 2A11 OS=Oryctolagus cuniculus GN=CYP2A11 PE=1 SV=1 | 155 | 459 | 9.0E-14 |
| sp|P79202|CP11A_SHEEP | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Ovis aries GN=CYP11A1 PE=1 SV=1 | 142 | 463 | 1.0E-13 |
| sp|Q9SXS3|C93C2_GLYEC | 2-hydroxyisoflavanone synthase OS=Glycyrrhiza echinata GN=CYP93C2 PE=1 SV=1 | 244 | 463 | 1.0E-13 |
| sp|P27786|CP17A_MOUSE | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mus musculus GN=Cyp17a1 PE=1 SV=1 | 31 | 470 | 1.0E-13 |
| sp|Q9XHE7|C71DD_MENPI | Cytochrome P450 71D13 OS=Mentha piperita GN=CYP71D13 PE=1 SV=1 | 248 | 468 | 1.0E-13 |
| sp|Q9V4U9|C6A13_DROME | Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 | 154 | 471 | 1.0E-13 |
| sp|Q7Z449|CP2U1_HUMAN | Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 | 224 | 471 | 1.0E-13 |
| sp|Q9V419|C28A5_DROME | Probable cytochrome P450 28a5 OS=Drosophila melanogaster GN=Cyp28a5 PE=2 SV=1 | 78 | 463 | 1.0E-13 |
| sp|D5JBW8|GAO_CICIN | Germacrene A oxidase OS=Cichorium intybus PE=1 SV=1 | 19 | 466 | 1.0E-13 |
| sp|Q9VMT6|C28D2_DROME | Probable cytochrome P450 28d2 OS=Drosophila melanogaster GN=Cyp28d2 PE=3 SV=1 | 48 | 465 | 1.0E-13 |
| sp|P33274|CP4F1_RAT | Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 | 122 | 459 | 1.0E-13 |
| sp|D1MI46|C76BA_SWEMU | Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 | 247 | 477 | 1.0E-13 |
| sp|P33261|CP2CJ_HUMAN | Cytochrome P450 2C19 OS=Homo sapiens GN=CYP2C19 PE=1 SV=3 | 199 | 462 | 1.0E-13 |
| sp|Q6Z5I7|C76M6_ORYSJ | Oryzalexin E synthase OS=Oryza sativa subsp. japonica GN=CYP76M6 PE=1 SV=1 | 256 | 474 | 1.0E-13 |
| sp|Q9EP75|CP4FE_MOUSE | Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 | 122 | 459 | 1.0E-13 |
| sp|P9WPN1|C135A_MYCTU | Putative cytochrome P450 135A1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp135A1 PE=1 SV=1 | 36 | 462 | 1.0E-13 |
| sp|P9WPN0|C135A_MYCTO | Putative cytochrome P450 135A1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp135A1 PE=3 SV=1 | 36 | 462 | 1.0E-13 |
| sp|Q6YTF5|C76M5_ORYSJ | Cytochrome P450 76M5 OS=Oryza sativa subsp. japonica GN=CYP76M5 PE=1 SV=1 | 265 | 474 | 1.0E-13 |
| sp|Q4V8D1|CP2U1_RAT | Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 | 224 | 471 | 2.0E-13 |
| sp|Q6IV13|C7D95_MENSP | Cytochrome P450 71D95 OS=Mentha spicata GN=CYP71D95 PE=1 SV=1 | 248 | 467 | 2.0E-13 |
| sp|Q00714|STCS_EMENI | Probable sterigmatocystin biosynthesis P450 monooxygenase stcS OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcS PE=1 SV=2 | 123 | 462 | 2.0E-13 |
| sp|Q12581|CP52X_CANMA | Cytochrome P450 52A5 OS=Candida maltosa GN=CYP52A5 PE=1 SV=1 | 125 | 470 | 2.0E-13 |
| sp|A6YIH8|C7D55_HYOMU | Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 | 211 | 468 | 2.0E-13 |
| sp|Q6WKY9|C7D95_MENGR | Cytochrome P450 71D95 OS=Mentha gracilis GN=CYP71D95 PE=1 SV=1 | 248 | 467 | 2.0E-13 |
| sp|P11715|CP17A_RAT | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rattus norvegicus GN=Cyp17a1 PE=1 SV=2 | 294 | 473 | 2.0E-13 |
| sp|O18963|CP2E1_BOVIN | Cytochrome P450 2E1 OS=Bos taurus GN=CYP2E1 PE=2 SV=1 | 176 | 469 | 2.0E-13 |
| sp|P05181|CP2E1_HUMAN | Cytochrome P450 2E1 OS=Homo sapiens GN=CYP2E1 PE=1 SV=1 | 182 | 468 | 2.0E-13 |
| sp|Q9V4T5|CP4E1_DROME | Probable cytochrome P450 4e1 OS=Drosophila melanogaster GN=Cyp4e1 PE=2 SV=1 | 113 | 503 | 2.0E-13 |
| sp|Q6YV88|C71Z7_ORYSJ | Ent-cassadiene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z7 PE=1 SV=1 | 170 | 477 | 2.0E-13 |
| sp|Q9VCW1|CP6D4_DROME | Probable cytochrome P450 6d4 OS=Drosophila melanogaster GN=Cyp6d4 PE=2 SV=1 | 101 | 493 | 2.0E-13 |
| sp|P37117|C71A4_SOLME | Cytochrome P450 71A4 OS=Solanum melongena GN=CYP71A4 PE=2 SV=1 | 248 | 466 | 2.0E-13 |
| sp|Q9V4U7|C6A14_DROME | Probable cytochrome P450 6a14 OS=Drosophila melanogaster GN=Cyp6a14 PE=3 SV=2 | 78 | 476 | 2.0E-13 |
| sp|P11712|CP2C9_HUMAN | Cytochrome P450 2C9 OS=Homo sapiens GN=CYP2C9 PE=1 SV=3 | 199 | 462 | 2.0E-13 |
| sp|Q42600|C84A1_ARATH | Cytochrome P450 84A1 OS=Arabidopsis thaliana GN=CYP84A1 PE=1 SV=1 | 279 | 467 | 2.0E-13 |
| sp|P48420|C78A1_MAIZE | Cytochrome P450 78A1 OS=Zea mays GN=CYP78A1 PE=2 SV=1 | 88 | 466 | 3.0E-13 |
| sp|C0SJS2|C71AJ_PASSA | Psoralen synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ3 PE=1 SV=1 | 258 | 469 | 3.0E-13 |
| sp|Q9GMC7|CP17A_BISBI | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bison bison GN=CYP17A1 PE=2 SV=1 | 294 | 473 | 3.0E-13 |
| sp|P51869|CP4F4_RAT | Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 | 125 | 461 | 3.0E-13 |
| sp|B5BSX1|BAMO_GLYUR | Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 | 260 | 459 | 3.0E-13 |
| sp|Q7X7X4|C99A2_ORYSJ | Cytochrome P450 99A2 OS=Oryza sativa subsp. japonica GN=CYP99A2 PE=2 SV=2 | 235 | 467 | 3.0E-13 |
| sp|P37118|C71A2_SOLME | Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 | 248 | 467 | 3.0E-13 |
| sp|Q7Y1V5|C78AB_ORYSJ | Cytochrome P450 78A11 OS=Oryza sativa subsp. japonica GN=CYP78A11 PE=1 SV=2 | 248 | 466 | 3.0E-13 |
| sp|Q9SBQ9|F3PH_PETHY | Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1 | 177 | 460 | 3.0E-13 |
| sp|Q59990|CP120_SYNY3 | Putative cytochrome P450 120 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cyp120 PE=1 SV=1 | 207 | 469 | 3.0E-13 |
| sp|G4XV71|C93C2_GLYUR | 2-hydroxyisoflavanone synthase OS=Glycyrrhiza uralensis GN=CYP93C2 PE=2 SV=2 | 244 | 463 | 3.0E-13 |
| sp|P48421|C83A1_ARATH | Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 | 289 | 467 | 3.0E-13 |
| sp|O23365|C97B3_ARATH | Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 | 125 | 495 | 3.0E-13 |
| sp|P82713|CP392_DROME | Probable cytochrome P450 309a2 OS=Drosophila melanogaster GN=Cyp309a2 PE=2 SV=2 | 183 | 461 | 4.0E-13 |
| sp|P10611|CP4A4_RABIT | Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 | 123 | 471 | 4.0E-13 |
| sp|Q29552|C11B1_PIG | Cytochrome P450 11B1, mitochondrial OS=Sus scrofa GN=CYP11B1 PE=2 SV=1 | 281 | 462 | 4.0E-13 |
| sp|Q9VB31|C6A18_DROME | Probable cytochrome P450 6a18 OS=Drosophila melanogaster GN=Cyp6a18 PE=2 SV=1 | 49 | 462 | 4.0E-13 |
| sp|P51871|CP4F6_RAT | Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 | 125 | 461 | 4.0E-13 |
| sp|O64638|C76C3_ARATH | Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2 | 148 | 467 | 4.0E-13 |
| sp|O44220|C12B1_DROAC | Cytochrome P450 12b1, mitochondrial OS=Drosophila acanthoptera GN=Cyp12b1 PE=2 SV=1 | 28 | 462 | 4.0E-13 |
| sp|Q9V9L1|CP6W1_DROME | Probable cytochrome P450 6w1 OS=Drosophila melanogaster GN=Cyp6w1 PE=2 SV=1 | 129 | 456 | 4.0E-13 |
| sp|Q9VA27|CP4C3_DROME | Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 | 121 | 461 | 4.0E-13 |
| sp|Q9VYQ7|CP311_DROME | Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 | 33 | 465 | 4.0E-13 |
| sp|O65790|C81F1_ARATH | Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2 | 258 | 460 | 4.0E-13 |
| sp|Q9GJX5|CP4AL_PIG | Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 | 279 | 465 | 4.0E-13 |
| sp|Q9LIP4|C71BX_ARATH | Cytochrome P450 71B36 OS=Arabidopsis thaliana GN=CYP71B36 PE=3 SV=1 | 124 | 467 | 5.0E-13 |
| sp|P20852|CP2A5_MOUSE | Cytochrome P450 2A5 OS=Mus musculus GN=Cyp2a5 PE=2 SV=1 | 155 | 469 | 5.0E-13 |
| sp|Q9LHA1|C8D11_ARATH | Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 | 179 | 460 | 5.0E-13 |
| sp|O73853|CP17A_ICTPU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 | 182 | 470 | 5.0E-13 |
| sp|P20812|CP2A3_RAT | Cytochrome P450 2A3 OS=Rattus norvegicus GN=Cyp2a3 PE=2 SV=1 | 155 | 464 | 6.0E-13 |
| sp|P79152|CP3AJ_CAPHE | Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 | 284 | 459 | 6.0E-13 |
| sp|H2DH24|C7D47_PANGI | Cytochrome P450 CYP82D47 OS=Panax ginseng PE=2 SV=1 | 291 | 459 | 6.0E-13 |
| sp|Q27517|C13A3_CAEEL | Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 | 83 | 471 | 6.0E-13 |
| sp|G3GBK0|C7BL3_CICIN | Costunolide synthase OS=Cichorium intybus GN=CYP71BL3 PE=1 SV=1 | 58 | 467 | 7.0E-13 |
| sp|P56592|CP1A2_CANLF | Cytochrome P450 1A2 OS=Canis lupus familiaris GN=CYP1A2 PE=1 SV=2 | 21 | 469 | 7.0E-13 |
| sp|O62671|CP241_CANLF | Cytochrome P450 2C41 OS=Canis lupus familiaris GN=CYP2C41 PE=2 SV=1 | 199 | 468 | 7.0E-13 |
| sp|P05185|CP17A_BOVIN | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bos taurus GN=CYP17A1 PE=2 SV=1 | 276 | 473 | 7.0E-13 |
| sp|Q9GMC8|CP17A_FELCA | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Felis catus GN=CYP17A1 PE=2 SV=1 | 294 | 500 | 7.0E-13 |
| sp|P15539|C11B2_MOUSE | Cytochrome P450 11B2, mitochondrial OS=Mus musculus GN=Cyp11b2 PE=2 SV=3 | 256 | 461 | 7.0E-13 |
| sp|P51581|CP2E1_MESAU | Cytochrome P450 2E1 OS=Mesocricetus auratus GN=CYP2E1 PE=2 SV=1 | 181 | 469 | 7.0E-13 |
| sp|P05108|CP11A_HUMAN | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Homo sapiens GN=CYP11A1 PE=1 SV=2 | 92 | 463 | 8.0E-13 |
| sp|Q9V6H1|CP9H1_DROME | Probable cytochrome P450 9h1 OS=Drosophila melanogaster GN=Cyp9h1 PE=3 SV=1 | 110 | 461 | 8.0E-13 |
| sp|O48921|C97B2_SOYBN | Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 | 125 | 495 | 8.0E-13 |
| sp|H1A981|C7263_MEDTR | 11-oxo-beta-amyrin 30-oxidase OS=Medicago truncatula GN=CYP72A63 PE=1 SV=1 | 83 | 466 | 9.0E-13 |
| sp|Q9VL92|CP4E3_DROME | Cytochrome P450 4e3 OS=Drosophila melanogaster GN=Cyp4e3 PE=2 SV=1 | 123 | 468 | 9.0E-13 |
| sp|Q50EK1|C16B1_PICSI | Cytochrome P450 716B1 OS=Picea sitchensis GN=CYP716B1 PE=2 SV=1 | 248 | 460 | 9.0E-13 |
| sp|P00189|CP11A_BOVIN | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Bos taurus GN=CYP11A1 PE=1 SV=1 | 142 | 463 | 9.0E-13 |
| sp|Q96418|C75A5_EUSER | Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A5 PE=2 SV=1 | 248 | 467 | 1.0E-12 |
| sp|L7X0L7|P6H_PAPSO | Protopine 6-monooxygenase OS=Papaver somniferum GN=CYP82N3 PE=2 SV=1 | 239 | 471 | 1.0E-12 |
| sp|S4UX02|CYPH1_SALMI | Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 | 294 | 460 | 1.0E-12 |
| sp|O65788|C71B2_ARATH | Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2 | 220 | 466 | 1.0E-12 |
| sp|H2KYS3|DAF9_CAEEL | Cytochrome P450 daf-9 OS=Caenorhabditis elegans GN=daf-9 PE=1 SV=1 | 296 | 474 | 1.0E-12 |
| sp|Q9CA60|C98A9_ARATH | Cytochrome P450 98A9 OS=Arabidopsis thaliana GN=CYP98A9 PE=1 SV=1 | 167 | 459 | 1.0E-12 |
| sp|P14580|CP4A6_RABIT | Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 | 123 | 461 | 1.0E-12 |
| sp|P79402|CP242_PIG | Cytochrome P450 2C42 (Fragment) OS=Sus scrofa GN=CYP2C42 PE=2 SV=1 | 198 | 461 | 1.0E-12 |
| sp|Q9LIP6|C71BV_ARATH | Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1 | 135 | 469 | 1.0E-12 |
| sp|Q949P1|ABAH1_ARATH | Abscisic acid 8'-hydroxylase 1 OS=Arabidopsis thaliana GN=CYP707A1 PE=2 SV=1 | 227 | 468 | 1.0E-12 |
| sp|P00187|CP1A2_RABIT | Cytochrome P450 1A2 OS=Oryctolagus cuniculus GN=CYP1A2 PE=1 SV=3 | 32 | 467 | 1.0E-12 |
| sp|D5J9U8|GAO_LACSA | Germacrene A oxidase OS=Lactuca sativa GN=GAO1 PE=1 SV=1 | 14 | 466 | 2.0E-12 |
| sp|Q95328|CP17A_HORSE | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Equus caballus GN=CYP17A1 PE=2 SV=1 | 277 | 500 | 2.0E-12 |
| sp|F8S1I0|C7BL2_LACSA | Costunolide synthase OS=Lactuca sativa GN=CYP71BL2 PE=1 SV=1 | 58 | 467 | 2.0E-12 |
| sp|Q9FF18|C7351_ARATH | Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A1 PE=1 SV=1 | 125 | 463 | 2.0E-12 |
| sp|P08516|CP4AA_RAT | Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 | 123 | 471 | 2.0E-12 |
| sp|P10612|CP11A_PIG | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Sus scrofa GN=CYP11A1 PE=1 SV=1 | 142 | 463 | 2.0E-12 |
| sp|P24465|C71A1_PERAE | Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 | 247 | 464 | 2.0E-12 |
| sp|Q05555|CP2AA_RABIT | Cytochrome P450 2A10 OS=Oryctolagus cuniculus GN=CYP2A10 PE=1 SV=1 | 155 | 459 | 2.0E-12 |
| sp|O55071|CP2BJ_MOUSE | Cytochrome P450 2B19 OS=Mus musculus GN=Cyp2b19 PE=2 SV=1 | 159 | 464 | 2.0E-12 |
| sp|Q9STL0|C71AN_ARATH | Cytochrome P450 71A23 OS=Arabidopsis thaliana GN=CYP71A23 PE=2 SV=1 | 143 | 460 | 2.0E-12 |
| sp|Q0IIF9|CP2U1_BOVIN | Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 | 150 | 464 | 2.0E-12 |
| sp|Q9LSF8|C82G1_ARATH | Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 | 163 | 470 | 2.0E-12 |
| sp|Q6GUQ4|CP2E1_MACMU | Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE=2 SV=1 | 199 | 468 | 2.0E-12 |
| sp|Q16696|CP2AD_HUMAN | Cytochrome P450 2A13 OS=Homo sapiens GN=CYP2A13 PE=1 SV=3 | 155 | 464 | 2.0E-12 |
| sp|P14581|CP4A7_RABIT | Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 | 123 | 471 | 2.0E-12 |
| sp|Q947B7|MFS_MENPI | (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 | 256 | 466 | 3.0E-12 |
| sp|Q9HCS2|CP4FC_HUMAN | Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 | 122 | 459 | 3.0E-12 |
| sp|Q07217|CP11A_ONCMY | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Oncorhynchus mykiss GN=cyp11a1 PE=2 SV=1 | 264 | 469 | 3.0E-12 |
| sp|P33260|CP2CI_HUMAN | Cytochrome P450 2C18 OS=Homo sapiens GN=CYP2C18 PE=1 SV=3 | 199 | 469 | 3.0E-12 |
| sp|P29980|CPXN_NOSS1 | Probable cytochrome P450 110 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cyp110 PE=3 SV=3 | 62 | 471 | 3.0E-12 |
| sp|P15392|CP2A4_MOUSE | Cytochrome P450 2A4 OS=Mus musculus GN=Cyp2a4 PE=2 SV=3 | 155 | 459 | 3.0E-12 |
| sp|Q9V8M2|C12B2_DROME | Probable cytochrome P450 12b2, mitochondrial OS=Drosophila melanogaster GN=Cyp12b2 PE=2 SV=2 | 36 | 462 | 3.0E-12 |
| sp|Q94FM7|C71DK_TOBAC | 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 | 248 | 477 | 4.0E-12 |
| sp|Q556M4|C5082_DICDI | Probable cytochrome P450 508A2 OS=Dictyostelium discoideum GN=cyp508A2-1 PE=3 SV=1 | 263 | 494 | 4.0E-12 |
| sp|P93149|C93B1_GLYEC | Licodione synthase OS=Glycyrrhiza echinata GN=CYP93B1 PE=1 SV=2 | 254 | 463 | 5.0E-12 |
| sp|O46515|CP11A_HORSE | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Equus caballus GN=CYP11A1 PE=3 SV=1 | 142 | 463 | 5.0E-12 |
| sp|O18635|C12A2_MUSDO | Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 | 157 | 461 | 5.0E-12 |
| sp|P05179|CP2C7_RAT | Cytochrome P450 2C7 OS=Rattus norvegicus GN=Cyp2c7 PE=1 SV=2 | 199 | 462 | 5.0E-12 |
| sp|P00180|CP2C1_RABIT | Cytochrome P450 2C1 OS=Oryctolagus cuniculus GN=CYP2C1 PE=1 SV=2 | 199 | 459 | 5.0E-12 |
| sp|O18596|C4D10_DROMT | Cytochrome P450 4d10 OS=Drosophila mettleri GN=Cyp4d10 PE=1 SV=1 | 123 | 493 | 5.0E-12 |
| sp|Q27606|CP4E2_DROME | Cytochrome P450 4e2 OS=Drosophila melanogaster GN=Cyp4e2 PE=2 SV=2 | 113 | 461 | 5.0E-12 |
| sp|Q29497|CP17A_SHEEP | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ovis aries GN=CYP17A1 PE=2 SV=2 | 294 | 473 | 5.0E-12 |
| sp|Q9V559|CP4P3_DROME | Probable cytochrome P450 4p3 OS=Drosophila melanogaster GN=Cyp4p3 PE=2 SV=3 | 263 | 494 | 5.0E-12 |
| sp|Q9FI39|THAD_ARATH | Cytochrome P450 705A5 OS=Arabidopsis thaliana GN=CYP705A5 PE=2 SV=1 | 248 | 460 | 5.0E-12 |
| sp|Q9FVS9|C96AF_ARATH | Alkane hydroxylase MAH1 OS=Arabidopsis thaliana GN=CYP96A15 PE=2 SV=1 | 277 | 466 | 6.0E-12 |
| sp|Q9VMS9|C4AC1_DROME | Probable cytochrome P450 4ac1 OS=Drosophila melanogaster GN=Cyp4ac1 PE=2 SV=1 | 288 | 461 | 6.0E-12 |
| sp|P37120|C75A2_SOLME | Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1 | 263 | 467 | 6.0E-12 |
| sp|Q96581|C75A4_GENTR | Flavonoid 3',5'-hydroxylase OS=Gentiana triflora GN=CYP75A4 PE=2 SV=1 | 263 | 460 | 6.0E-12 |
| sp|P00191|CP21A_BOVIN | Steroid 21-hydroxylase OS=Bos taurus GN=CYP21 PE=1 SV=2 | 147 | 499 | 6.0E-12 |
| sp|P56656|CP239_MOUSE | Cytochrome P450 2C39 OS=Mus musculus GN=Cyp2c39 PE=1 SV=2 | 199 | 469 | 6.0E-12 |
| sp|Q9VGB3|CP133_DROME | Probable cytochrome P450 313a3 OS=Drosophila melanogaster GN=Cyp313a3 PE=3 SV=2 | 83 | 462 | 6.0E-12 |
| sp|B9DFU2|MAX1_ARATH | Cytochrome P450 711A1 OS=Arabidopsis thaliana GN=CYP711A1 PE=2 SV=1 | 259 | 455 | 7.0E-12 |
| sp|P30608|CP52F_CANTR | Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 | 269 | 470 | 7.0E-12 |
| sp|Q6XVG2|CP254_MOUSE | Cytochrome P450 2C54 OS=Mus musculus GN=Cyp2c54 PE=1 SV=1 | 196 | 462 | 7.0E-12 |
| sp|C0SJS3|ANGS_PASSA | Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 | 260 | 466 | 7.0E-12 |
| sp|P05182|CP2E1_RAT | Cytochrome P450 2E1 OS=Rattus norvegicus GN=Cyp2e1 PE=1 SV=4 | 182 | 469 | 7.0E-12 |
| sp|P98183|C71DC_CATRO | Tabersonine 16-hydroxylase (Fragment) OS=Catharanthus roseus GN=CYP71D12 PE=1 SV=1 | 159 | 460 | 8.0E-12 |
| sp|Q6NT55|CP4FN_HUMAN | Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 | 122 | 463 | 9.0E-12 |
| sp|O44221|CP4E5_DROMT | Cytochrome P450 4e5, mitochondrial OS=Drosophila mettleri GN=Cyp4e5 PE=2 SV=1 | 123 | 468 | 9.0E-12 |
| sp|Q9N0U7|CP17A_CAPHI | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Capra hircus GN=CYP17A1 PE=2 SV=1 | 276 | 473 | 9.0E-12 |
| sp|Q5IZM4|CP51_MYCVP | Lanosterol 14-alpha demethylase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=cyp51 PE=3 SV=1 | 248 | 465 | 1.0E-11 |
| sp|Q6GUR1|CP1A1_MACMU | Cytochrome P450 1A1 OS=Macaca mulatta GN=CYP1A1 PE=2 SV=1 | 236 | 469 | 1.0E-11 |
| sp|O54749|CP2J5_MOUSE | Cytochrome P450 2J5 OS=Mus musculus GN=Cyp2j5 PE=1 SV=1 | 270 | 464 | 1.0E-11 |
| sp|P16496|CP52C_CANMA | Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 | 208 | 460 | 1.0E-11 |
| sp|Q86W10|CP4Z1_HUMAN | Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 | 270 | 465 | 1.0E-11 |
| sp|Q50EK0|C16B2_PICSI | Cytochrome P450 716B2 OS=Picea sitchensis GN=CYP716B2 PE=2 SV=1 | 248 | 456 | 1.0E-11 |
| sp|Q2LA59|CP21A_LYNLY | Steroid 21-hydroxylase OS=Lynx lynx GN=CYP21 PE=3 SV=1 | 148 | 504 | 1.0E-11 |
| sp|Q2LA60|CP21A_FELCA | Steroid 21-hydroxylase OS=Felis catus GN=CYP21 PE=3 SV=1 | 148 | 504 | 1.0E-11 |
| sp|Q9Y757|CP52L_DEBHN | Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 | 269 | 459 | 1.0E-11 |
| sp|O81973|C93A3_SOYBN | Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1 | 247 | 459 | 1.0E-11 |
| sp|Q5RBQ1|CP1A2_PONAB | Cytochrome P450 1A2 OS=Pongo abelii GN=CYP1A2 PE=2 SV=3 | 265 | 469 | 1.0E-11 |
| sp|Q3LFT9|CP1A2_BALAC | Cytochrome P450 1A2 OS=Balaenoptera acutorostrata GN=CYP1A2 PE=2 SV=3 | 265 | 469 | 1.0E-11 |
| sp|B9X287|C7346_ORYSJ | Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 | 79 | 460 | 1.0E-11 |
| sp|Q9MZY0|CP2E1_CANLF | Cytochrome P450 2E1 OS=Canis lupus familiaris GN=CYP2E1 PE=2 SV=1 | 159 | 469 | 1.0E-11 |
| sp|P97720|C11B1_MESAU | Cytochrome P450 11B1, mitochondrial OS=Mesocricetus auratus GN=CYP11B1 PE=2 SV=1 | 265 | 469 | 1.0E-11 |
| sp|Q27593|CP6A8_DROME | Cytochrome P450 6a8 OS=Drosophila melanogaster GN=Cyp6a8 PE=2 SV=2 | 99 | 462 | 1.0E-11 |
| sp|Q27518|C13A2_CAEEL | Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 | 83 | 460 | 1.0E-11 |
| sp|Q9VJ71|CP310_DROME | Probable cytochrome P450 310a1 OS=Drosophila melanogaster GN=Cyp310a1 PE=2 SV=1 | 128 | 463 | 1.0E-11 |
| sp|O80823|C86A8_ARATH | Cytochrome P450 86A8 OS=Arabidopsis thaliana GN=CYP86A8 PE=2 SV=1 | 159 | 466 | 2.0E-11 |
| sp|Q43078|C97B1_PEA | Cytochrome P450 97B1, chloroplastic OS=Pisum sativum GN=CYP97B1 PE=2 SV=1 | 67 | 447 | 2.0E-11 |
| sp|P17666|CP2CE_RABIT | Cytochrome P450 2C14 OS=Oryctolagus cuniculus GN=CYP2C14 PE=2 SV=1 | 245 | 468 | 2.0E-11 |
| sp|P33616|CP1A1_MACFA | Cytochrome P450 1A1 OS=Macaca fascicularis GN=CYP1A1 PE=2 SV=1 | 236 | 469 | 2.0E-11 |
| sp|Q9K498|EIZFM_STRCO | Epi-isozizaene 5-monooxygenase/(E)-beta-farnesene synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5223 PE=1 SV=1 | 259 | 459 | 2.0E-11 |
| sp|O88833|CP4AA_MOUSE | Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 | 123 | 461 | 2.0E-11 |
| sp|Q64658|C11B2_MESAU | Cytochrome P450 11B2, mitochondrial OS=Mesocricetus auratus GN=CYP11B2 PE=2 SV=1 | 285 | 469 | 2.0E-11 |
| sp|O81974|C71D8_SOYBN | Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 | 250 | 464 | 2.0E-11 |
| sp|Q9V675|CP6G2_DROME | Probable cytochrome P450 6g2 OS=Drosophila melanogaster GN=Cyp6g2 PE=2 SV=1 | 83 | 456 | 2.0E-11 |
| sp|P33266|CP2E1_MACFA | Cytochrome P450 2E1 (Fragment) OS=Macaca fascicularis GN=CYP2E1 PE=2 SV=1 | 201 | 468 | 2.0E-11 |
| sp|P56593|CP2AC_MOUSE | Cytochrome P450 2A12 OS=Mus musculus GN=Cyp2a12 PE=1 SV=2 | 155 | 464 | 2.0E-11 |
| sp|Q64562|CP21A_RAT | Steroid 21-hydroxylase OS=Rattus norvegicus GN=Cyp21 PE=2 SV=1 | 240 | 470 | 2.0E-11 |
| sp|Q96SQ9|CP2S1_HUMAN | Cytochrome P450 2S1 OS=Homo sapiens GN=CYP2S1 PE=1 SV=2 | 239 | 464 | 2.0E-11 |
| sp|O54750|CP2J6_MOUSE | Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 | 153 | 464 | 2.0E-11 |
| sp|Q92045|CP11A_DASAM | Cholesterol side-chain cleavage enzyme, mitochondrial (Fragment) OS=Dasyatis americana GN=CYP11A1 PE=2 SV=1 | 123 | 469 | 2.0E-11 |
| sp|Q92104|CP11B_LITCT | Cytochrome P450 11B, mitochondrial OS=Lithobates catesbeiana GN=CYP11B PE=2 SV=1 | 142 | 469 | 3.0E-11 |
| sp|Q9SD85|F3PH_ARATH | Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 | 166 | 467 | 3.0E-11 |
| sp|Q9FIB0|C78A7_ARATH | Cytochrome P450 78A7 OS=Arabidopsis thaliana GN=CYP78A7 PE=2 SV=1 | 248 | 460 | 3.0E-11 |
| sp|Q2KIG5|THAS_BOVIN | Thromboxane-A synthase OS=Bos taurus GN=TBXAS1 PE=2 SV=1 | 106 | 493 | 3.0E-11 |
| sp|O04790|C75A7_EUSER | Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A7 PE=2 SV=1 | 248 | 467 | 3.0E-11 |
| sp|Q00557|CP1A1_MESAU | Cytochrome P450 1A1 OS=Mesocricetus auratus GN=CYP1A1 PE=2 SV=2 | 55 | 472 | 3.0E-11 |
| sp|Q9T0K0|C71AJ_ARATH | Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1 | 250 | 461 | 3.0E-11 |
| sp|Q8SPK0|CP4AP_PIG | Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 | 125 | 466 | 3.0E-11 |
| sp|Q9SAB6|C71AI_ARATH | Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=CYP71A18 PE=2 SV=2 | 248 | 466 | 4.0E-11 |
| sp|Q948Y1|C719A_COPJA | (S)-canadine synthase OS=Coptis japonica GN=CYP719A1 PE=1 SV=1 | 298 | 494 | 4.0E-11 |
| sp|P48419|C75A3_PETHY | Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1 | 36 | 467 | 4.0E-11 |
| sp|H2DH18|C7A12_PANGI | Cytochrome P450 CYP736A12 OS=Panax ginseng PE=2 SV=1 | 248 | 466 | 5.0E-11 |
| sp|P51590|CP2J3_RAT | Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 | 262 | 477 | 5.0E-11 |
| sp|Q9VUF8|CP314_DROME | Ecdysone 20-monooxygenase OS=Drosophila melanogaster GN=shd PE=1 SV=3 | 36 | 493 | 5.0E-11 |
| sp|P33270|CP6A2_DROME | Cytochrome P450 6a2 OS=Drosophila melanogaster GN=Cyp6a2 PE=2 SV=2 | 125 | 471 | 5.0E-11 |
| sp|P15150|C11B1_BOVIN | Cytochrome P450 11B1, mitochondrial OS=Bos taurus GN=CYP11B1 PE=1 SV=2 | 282 | 471 | 5.0E-11 |
| sp|Q9VMS7|C4AC3_DROME | Probable cytochrome P450 4ac3 OS=Drosophila melanogaster GN=Cyp4ac3 PE=2 SV=2 | 288 | 461 | 5.0E-11 |
| sp|P00185|CP1A1_RAT | Cytochrome P450 1A1 OS=Rattus norvegicus GN=Cyp1a1 PE=1 SV=1 | 36 | 466 | 5.0E-11 |
| sp|Q9T0K2|C71AK_ARATH | Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 | 258 | 461 | 6.0E-11 |
| sp|Q964R1|CP6J1_BLAGE | Cytochrome P450 6j1 OS=Blattella germanica GN=CYP6J1 PE=2 SV=1 | 211 | 462 | 6.0E-11 |
| sp|Q9V773|C6A20_DROME | Probable cytochrome P450 6a20 OS=Drosophila melanogaster GN=Cyp6a20 PE=2 SV=2 | 110 | 465 | 6.0E-11 |
| sp|D5JBX1|GAO_BARSP | Germacrene A oxidase OS=Barnadesia spinosa PE=1 SV=1 | 33 | 469 | 6.0E-11 |
| sp|Q50LH3|C7192_ESCCA | (S)-stylopine synthase 1 OS=Eschscholzia californica GN=CYP719A2 PE=1 SV=1 | 131 | 494 | 7.0E-11 |
| sp|Q9FMY1|C86B1_ARATH | Cytochrome P450 86B1 OS=Arabidopsis thaliana GN=CYP86B1 PE=2 SV=1 | 134 | 505 | 7.0E-11 |
| sp|P56654|CP237_MOUSE | Cytochrome P450 2C37 OS=Mus musculus GN=Cyp2c37 PE=1 SV=2 | 285 | 462 | 7.0E-11 |
| sp|P11711|CP2A1_RAT | Cytochrome P450 2A1 OS=Rattus norvegicus GN=Cyp2a1 PE=1 SV=2 | 155 | 464 | 8.0E-11 |
| sp|P82711|C6A19_DROME | Probable cytochrome P450 6a19 OS=Drosophila melanogaster GN=Cyp6a19 PE=3 SV=1 | 101 | 471 | 8.0E-11 |
| sp|E3W9C4|C71A1_ZINZE | Alpha-humulene 10-hydroxylase OS=Zingiber zerumbet GN=CYP71BA1 PE=1 SV=1 | 265 | 469 | 8.0E-11 |
| sp|Q05421|CP2E1_MOUSE | Cytochrome P450 2E1 OS=Mus musculus GN=Cyp2e1 PE=1 SV=1 | 182 | 469 | 8.0E-11 |
| sp|Q9LJK2|ABAH4_ARATH | Abscisic acid 8'-hydroxylase 4 OS=Arabidopsis thaliana GN=CYP707A4 PE=2 SV=2 | 235 | 466 | 8.0E-11 |
| sp|P56655|CP238_MOUSE | Cytochrome P450 2C38 OS=Mus musculus GN=Cyp2c38 PE=2 SV=2 | 199 | 469 | 8.0E-11 |
| sp|D4AY62|A1131_ARTBC | Cytochrome P450 ARB_01131 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01131 PE=3 SV=1 | 266 | 460 | 8.0E-11 |
| sp|Q42569|C90A1_ARATH | Cytochrome P450 90A1 OS=Arabidopsis thaliana GN=CYP90A1 PE=2 SV=1 | 265 | 459 | 9.0E-11 |
| sp|P0DKI7|STORR_PAPSO | Bifunctional protein STORR OS=Papaver somniferum GN=STORR PE=1 SV=1 | 174 | 469 | 9.0E-11 |
| sp|P30612|CP52P_CANTR | Cytochrome P450 52C1 OS=Candida tropicalis GN=CYP52C1 PE=2 SV=1 | 278 | 459 | 9.0E-11 |
| sp|F8S1H3|C7BL1_HELAN | Cytochrome P450 71BL1 OS=Helianthus annuus GN=CYP71BL1 PE=2 SV=1 | 248 | 467 | 9.0E-11 |
| sp|O57525|CP17A_RANDY | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rana dybowskii GN=CYP17A1 PE=2 SV=1 | 223 | 473 | 9.0E-11 |
| sp|P05177|CP1A2_HUMAN | Cytochrome P450 1A2 OS=Homo sapiens GN=CYP1A2 PE=1 SV=3 | 265 | 469 | 9.0E-11 |
| sp|Q9STK7|C71AQ_ARATH | Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 | 250 | 460 | 9.0E-11 |
| sp|Q8SPK1|CP4AO_PIG | Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 | 125 | 465 | 1.0E-10 |
| sp|P33272|CP2BC_RAT | Cytochrome P450 2B12 OS=Rattus norvegicus GN=Cyp2b12 PE=2 SV=1 | 155 | 464 | 1.0E-10 |
| sp|Q9EPT4|CP11A_MESAU | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mesocricetus auratus GN=CYP11A1 PE=2 SV=1 | 49 | 463 | 1.0E-10 |
| sp|Q55AJ4|C516B_DICDI | Probable cytochrome P450 516B1 OS=Dictyostelium discoideum GN=cyp516B1 PE=3 SV=1 | 123 | 471 | 1.0E-10 |
| sp|P15393|C11B1_RAT | Cytochrome P450 11B1, mitochondrial OS=Rattus norvegicus GN=Cyp11b1 PE=1 SV=1 | 278 | 469 | 1.0E-10 |
| sp|P48416|CP10_LYMST | Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1 | 288 | 462 | 1.0E-10 |
| sp|P24464|CP4AC_RAT | Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 | 125 | 471 | 1.0E-10 |
| sp|O77810|CP1A2_CALJA | Cytochrome P450 1A2 OS=Callithrix jacchus GN=CYP1A2 PE=2 SV=3 | 45 | 469 | 1.0E-10 |
| sp|O46658|CP2DP_PIG | Vitamin D(3) 25-hydroxylase OS=Sus scrofa GN=CYP2D25 PE=1 SV=3 | 248 | 470 | 1.0E-10 |
| sp|P00179|CP2C5_RABIT | Cytochrome P450 2C5 OS=Oryctolagus cuniculus GN=CYP2C5 PE=1 SV=2 | 199 | 462 | 1.0E-10 |
| sp|P24455|CP2A9_MESAU | Cytochrome P450 2A9 OS=Mesocricetus auratus GN=CYP2A9 PE=2 SV=2 | 155 | 468 | 1.0E-10 |
| sp|Q6XQ14|C71E7_MANES | 2-methylbutanal oxime monooxygenase OS=Manihot esculenta GN=CYP71E7 PE=1 SV=1 | 153 | 477 | 1.0E-10 |
| sp|F2Z9C1|P6H_ESCCA | Protopine 6-monooxygenase OS=Eschscholzia californica GN=CYP82N2v2 PE=1 SV=1 | 242 | 469 | 2.0E-10 |
| sp|P51663|C11B1_SHEEP | Cytochrome P450 11B1, mitochondrial OS=Ovis aries GN=CYP11B1 PE=2 SV=2 | 282 | 471 | 2.0E-10 |
| sp|Q9SHG5|C72C1_ARATH | Cytochrome P450 72C1 OS=Arabidopsis thaliana GN=CYP72C1 PE=2 SV=2 | 82 | 465 | 2.0E-10 |
| sp|B5UAQ8|C7195_ESCCA | Cheilanthifoline synthase OS=Eschscholzia californica GN=CYP719A5 PE=1 SV=1 | 298 | 495 | 2.0E-10 |
| sp|P00181|CP2C2_RABIT | Cytochrome P450 2C2 OS=Oryctolagus cuniculus GN=CYP2C2 PE=1 SV=2 | 247 | 459 | 2.0E-10 |
| sp|Q9VVN6|CP312_DROME | Probable cytochrome P450 312a1 OS=Drosophila melanogaster GN=Cyp312a1 PE=2 SV=1 | 277 | 459 | 2.0E-10 |
| sp|P14137|CP11A_RAT | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Rattus norvegicus GN=Cyp11a1 PE=2 SV=1 | 49 | 463 | 2.0E-10 |
| sp|Q27594|CP6A9_DROME | Cytochrome P450 6a9 OS=Drosophila melanogaster GN=Cyp6a9 PE=2 SV=3 | 231 | 492 | 2.0E-10 |
| sp|P56590|CP1A1_CANLF | Cytochrome P450 1A1 OS=Canis lupus familiaris GN=CYP1A1 PE=2 SV=1 | 254 | 469 | 2.0E-10 |
| sp|Q9STL1|C71AM_ARATH | Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1 | 152 | 464 | 2.0E-10 |
| sp|O65787|C71B6_ARATH | Cytochrome P450 71B6 OS=Arabidopsis thaliana GN=CYP71B6 PE=2 SV=1 | 248 | 460 | 2.0E-10 |
| sp|Q9SWR5|C93C1_SOYBN | 2-hydroxyisoflavanone synthase OS=Glycine max GN=IFS2 PE=2 SV=1 | 248 | 463 | 2.0E-10 |
| sp|Q9V558|CP4P1_DROME | Cytochrome P450 4p1 OS=Drosophila melanogaster GN=Cyp4p1 PE=2 SV=1 | 263 | 461 | 2.0E-10 |
| sp|Q69XM6|C7344_ORYSJ | Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 | 78 | 465 | 2.0E-10 |
| sp|Q1ZXL2|C518B_DICDI | Probable cytochrome P450 518B1 OS=Dictyostelium discoideum GN=cyp518B1 PE=3 SV=1 | 68 | 466 | 2.0E-10 |
| sp|Q4PJW3|CP51A_BOVIN | Lanosterol 14-alpha demethylase OS=Bos taurus GN=CYP51A1 PE=2 SV=1 | 341 | 466 | 2.0E-10 |
| sp|Q9LTM6|C71BH_ARATH | Cytochrome P450 71B17 OS=Arabidopsis thaliana GN=CYP71B17 PE=3 SV=1 | 248 | 467 | 2.0E-10 |
| sp|Q4WAW8|FTME_ASPFU | Fumitremorgin C synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-2 PE=3 SV=1 | 295 | 468 | 2.0E-10 |
| sp|B9WZX4|FTME_ASPFM | Fumitremorgin C synthase OS=Neosartorya fumigata GN=ftmP450-2 PE=1 SV=1 | 295 | 468 | 2.0E-10 |
| sp|Q64680|CP2DI_RAT | Cytochrome P450 2D18 OS=Rattus norvegicus GN=Cyp2d18 PE=2 SV=1 | 248 | 470 | 3.0E-10 |
| sp|P93531|C71D7_SOLCH | Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1 | 248 | 468 | 3.0E-10 |
| sp|P08686|CP21A_HUMAN | Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 PE=1 SV=1 | 148 | 470 | 3.0E-10 |
| sp|P9WPM5|CP137_MYCTU | Putative cytochrome P450 137 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp137 PE=1 SV=1 | 261 | 456 | 3.0E-10 |
| sp|P9WPM4|CP137_MYCTO | Putative cytochrome P450 137 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp137 PE=3 SV=1 | 261 | 456 | 3.0E-10 |
| sp|Q02928|CP4AB_HUMAN | Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE=1 SV=1 | 123 | 471 | 3.0E-10 |
| sp|P30607|CP52B_CANTR | Cytochrome P450 52A2 OS=Candida tropicalis GN=CYP52A2 PE=1 SV=1 | 284 | 459 | 3.0E-10 |
| sp|P56594|CP2CL_CANLF | Cytochrome P450 2C21 (Fragment) OS=Canis lupus familiaris GN=CYP2C21 PE=2 SV=2 | 247 | 468 | 3.0E-10 |
| sp|Q964T2|CP9E2_BLAGE | Cytochrome P450 9e2 OS=Blattella germanica GN=CYP9E2 PE=2 SV=1 | 37 | 471 | 3.0E-10 |
| sp|P79383|CP2E1_PIG | Cytochrome P450 2E1 OS=Sus scrofa GN=CYP2E1 PE=2 SV=1 | 182 | 469 | 3.0E-10 |
| sp|P11371|CP2C4_RABIT | Cytochrome P450 2C4 OS=Oryctolagus cuniculus GN=CYP2C4 PE=2 SV=1 | 199 | 462 | 3.0E-10 |
| sp|Q27756|CP6B3_PAPPO | Cytochrome P450 6B3 OS=Papilio polyxenes GN=CYP6B3 PE=2 SV=1 | 125 | 462 | 3.0E-10 |
| sp|O77809|CP1A2_MACFA | Cytochrome P450 1A2 OS=Macaca fascicularis GN=CYP1A2 PE=1 SV=3 | 125 | 469 | 3.0E-10 |
| sp|P33262|CP2CK_MACFA | Cytochrome P450 2C20 OS=Macaca fascicularis GN=CYP2C20 PE=2 SV=1 | 199 | 462 | 3.0E-10 |
| sp|O23066|C86A2_ARATH | Cytochrome P450 86A2 OS=Arabidopsis thaliana GN=CYP86A2 PE=1 SV=1 | 159 | 497 | 3.0E-10 |
| sp|P13108|CP2D4_RAT | Cytochrome P450 2D4 OS=Rattus norvegicus GN=Cyp2d4 PE=2 SV=2 | 248 | 470 | 3.0E-10 |
| sp|P00176|CP2B1_RAT | Cytochrome P450 2B1 OS=Rattus norvegicus GN=Cyp2b1 PE=1 SV=1 | 221 | 469 | 3.0E-10 |
| sp|Q29510|CP2CU_RABIT | Cytochrome P450 2C30 OS=Oryctolagus cuniculus GN=CYP2C30 PE=2 SV=1 | 224 | 468 | 3.0E-10 |
| sp|P05176|CP1A1_RABIT | Cytochrome P450 1A1 OS=Oryctolagus cuniculus GN=CYP1A1 PE=2 SV=1 | 247 | 472 | 4.0E-10 |
| sp|O46420|CP51A_PIG | Lanosterol 14-alpha demethylase OS=Sus scrofa GN=CYP51A1 PE=2 SV=1 | 341 | 466 | 4.0E-10 |
| sp|Q9SCN2|C71BU_ARATH | Cytochrome P450 71B31 OS=Arabidopsis thaliana GN=CYP71B31 PE=2 SV=1 | 294 | 469 | 4.0E-10 |
| sp|Q8TAV3|CP2W1_HUMAN | Cytochrome P450 2W1 OS=Homo sapiens GN=CYP2W1 PE=1 SV=2 | 223 | 468 | 4.0E-10 |
| sp|Q9LTL2|C71BP_ARATH | Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1 | 261 | 464 | 4.0E-10 |
| sp|P93530|C71D6_SOLCH | Cytochrome P450 71D6 OS=Solanum chacoense GN=CYP71D6 PE=2 SV=1 | 248 | 468 | 4.0E-10 |
| sp|B1NF20|C719E_ARGME | Cheilanthifoline synthase OS=Argemone mexicana GN=CYP719A14 PE=1 SV=1 | 285 | 493 | 4.0E-10 |
| sp|Q0J185|ABAH3_ORYSJ | Abscisic acid 8'-hydroxylase 3 OS=Oryza sativa subsp. japonica GN=CYP707A7 PE=2 SV=1 | 253 | 456 | 4.0E-10 |
| sp|O08394|CYPD_BACSU | Bifunctional cytochrome P450/NADPH--P450 reductase 1 OS=Bacillus subtilis (strain 168) GN=cypD PE=1 SV=1 | 127 | 459 | 4.0E-10 |
| sp|Q54ZM4|C518A_DICDI | Probable cytochrome P450 518A1 OS=Dictyostelium discoideum GN=cyp518A1 PE=3 SV=1 | 289 | 477 | 5.0E-10 |
| sp|A2Z212|ABAH3_ORYSI | Abscisic acid 8'-hydroxylase 3 OS=Oryza sativa subsp. indica GN=CYP707A7 PE=3 SV=1 | 253 | 456 | 5.0E-10 |
| sp|P12789|CP2B5_RABIT | Cytochrome P450 2B5 OS=Oryctolagus cuniculus GN=CYP2B5 PE=2 SV=1 | 239 | 476 | 5.0E-10 |
| sp|P04798|CP1A1_HUMAN | Cytochrome P450 1A1 OS=Homo sapiens GN=CYP1A1 PE=1 SV=1 | 254 | 469 | 5.0E-10 |
| sp|Q9FG65|C81D1_ARATH | Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1 | 85 | 460 | 5.0E-10 |
| sp|Q64654|CP51A_RAT | Lanosterol 14-alpha demethylase OS=Rattus norvegicus GN=Cyp51a1 PE=2 SV=1 | 341 | 466 | 5.0E-10 |
| sp|Q1ZXH9|CP51_DICDI | Probable lanosterol 14-alpha demethylase OS=Dictyostelium discoideum GN=cyp51 PE=3 SV=1 | 265 | 465 | 5.0E-10 |
| sp|O08336|CYPB_BACSU | Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 | 123 | 477 | 5.0E-10 |
| sp|Q9T093|C70B3_ARATH | Cytochrome P450 709B3 OS=Arabidopsis thaliana GN=CYP709B3 PE=2 SV=1 | 123 | 465 | 6.0E-10 |
| sp|Q9V770|C6A17_DROME | Probable cytochrome P450 6a17 OS=Drosophila melanogaster GN=Cyp6a17 PE=2 SV=1 | 125 | 471 | 6.0E-10 |
| sp|Q9V674|CP6G1_DROME | Cytochrome P450 6g1 OS=Drosophila melanogaster GN=Cyp6g1 PE=2 SV=1 | 111 | 461 | 6.0E-10 |
| sp|Q9FH76|ABAH3_ARATH | Abscisic acid 8'-hydroxylase 3 OS=Arabidopsis thaliana GN=CYP707A3 PE=1 SV=1 | 227 | 463 | 6.0E-10 |
| sp|Q91X77|CY250_MOUSE | Cytochrome P450 2C50 OS=Mus musculus GN=Cyp2c50 PE=1 SV=2 | 285 | 462 | 7.0E-10 |
| sp|O49858|C82A3_SOYBN | Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 | 288 | 464 | 7.0E-10 |
| sp|Q8K0C4|CP51A_MOUSE | Lanosterol 14-alpha demethylase OS=Mus musculus GN=Cyp51a1 PE=1 SV=1 | 265 | 466 | 7.0E-10 |
| sp|Q9SP06|C80B3_PAPSO | (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Papaver somniferum GN=CYP80B3 PE=1 SV=1 | 55 | 468 | 7.0E-10 |
| sp|P15149|CP2A2_RAT | Cytochrome P450 2A2 OS=Rattus norvegicus GN=Cyp2a2 PE=1 SV=1 | 159 | 468 | 7.0E-10 |
| sp|O48927|C78A3_SOYBN | Cytochrome P450 78A3 OS=Glycine max GN=CYP78A3 PE=2 SV=1 | 248 | 469 | 7.0E-10 |
| sp|E1B2Z9|C7AV8_CICIN | Cytochrome P450 71AV8 OS=Cichorium intybus GN=CYP71AV8 PE=2 SV=1 | 162 | 466 | 7.0E-10 |
| sp|Q16850|CP51A_HUMAN | Lanosterol 14-alpha demethylase OS=Homo sapiens GN=CYP51A1 PE=1 SV=3 | 341 | 466 | 8.0E-10 |
| sp|Q2PG45|THAS_MACFA | Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 | 265 | 493 | 8.0E-10 |
| sp|O81971|C71D9_SOYBN | Cytochrome P450 71D9 OS=Glycine max GN=CYP71D9 PE=2 SV=1 | 241 | 466 | 8.0E-10 |
| sp|O87605|PIKC_STRVZ | Cytochrome P450 monooxygenase PikC OS=Streptomyces venezuelae GN=pikC PE=1 SV=1 | 112 | 479 | 8.0E-10 |
| sp|P04167|CP2B2_RAT | Cytochrome P450 2B2 OS=Rattus norvegicus GN=Cyp2b2 PE=1 SV=2 | 221 | 469 | 9.0E-10 |
| sp|Q5RE72|CP51A_PONAB | Lanosterol 14-alpha demethylase OS=Pongo abelii GN=CYP51A1 PE=2 SV=2 | 341 | 466 | 9.0E-10 |
| sp|Q5KQT6|CP1A2_FELCA | Cytochrome P450 1A2 OS=Felis catus GN=CYP1A2 PE=2 SV=1 | 32 | 469 | 9.0E-10 |
| sp|P24458|CP52E_CANMA | Cytochrome P450 52A3-B OS=Candida maltosa GN=CYP52A3-B PE=1 SV=1 | 269 | 460 | 9.0E-10 |
| sp|O61387|CP6B7_HELAM | Cytochrome P450 6B7 OS=Helicoverpa armigera GN=CYP6B7 PE=2 SV=1 | 223 | 468 | 9.0E-10 |
| sp|Q4R8S6|CP51A_MACFA | Lanosterol 14-alpha demethylase OS=Macaca fascicularis GN=CYP51A1 PE=2 SV=2 | 341 | 466 | 9.0E-10 |
| sp|P33265|CP2CS_MESAU | Cytochrome P450 2C28 OS=Mesocricetus auratus GN=CYP2C28 PE=2 SV=1 | 245 | 461 | 9.0E-10 |
| sp|Q3LFU0|CP1A1_BALAC | Cytochrome P450 1A1 OS=Balaenoptera acutorostrata GN=CYP1A1 PE=2 SV=1 | 254 | 469 | 1.0E-09 |
| sp|Q9VRI9|CP6T1_DROME | Probable cytochrome P450 6t1 OS=Drosophila melanogaster GN=Cyp6t1 PE=2 SV=1 | 20 | 463 | 1.0E-09 |
| sp|P58048|C71B8_ARATH | Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 | 294 | 469 | 1.0E-09 |
| sp|P00178|CP2B4_RABIT | Cytochrome P450 2B4 OS=Oryctolagus cuniculus GN=CYP2B4 PE=1 SV=1 | 239 | 476 | 1.0E-09 |
| sp|P00184|CP1A1_MOUSE | Cytochrome P450 1A1 OS=Mus musculus GN=Cyp1a1 PE=1 SV=2 | 36 | 466 | 1.0E-09 |
| sp|P93147|C81E1_GLYEC | Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 | 248 | 474 | 1.0E-09 |
| sp|H2DH17|C7A22_PANGI | Cytochrome P450 CYP749A22 OS=Panax ginseng PE=2 SV=1 | 68 | 465 | 1.0E-09 |
| sp|Q9Y758|CP52M_DEBHN | Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=CYP52A13 PE=2 SV=1 | 269 | 460 | 1.0E-09 |
| sp|Q96423|TCMO_GLYEC | Trans-cinnamate 4-monooxygenase OS=Glycyrrhiza echinata GN=CYP73A14 PE=2 SV=1 | 313 | 466 | 1.0E-09 |
| sp|P24460|CP2BB_CANLF | Cytochrome P450 2B11 OS=Canis lupus familiaris GN=CYP2B11 PE=2 SV=1 | 155 | 464 | 1.0E-09 |
| sp|Q1ZXF5|C5084_DICDI | Probable cytochrome P450 508A4 OS=Dictyostelium discoideum GN=cyp508A4 PE=3 SV=1 | 57 | 466 | 1.0E-09 |
| sp|P56591|CP1A1_SHEEP | Cytochrome P450 1A1 OS=Ovis aries GN=CYP1A1 PE=2 SV=1 | 276 | 469 | 2.0E-09 |
| sp|Q50LH4|C7193_ESCCA | (S)-stylopine synthase 2 OS=Eschscholzia californica GN=CYP719A3 PE=1 SV=1 | 298 | 494 | 2.0E-09 |
| sp|P14779|CPXB_BACME | Bifunctional cytochrome P450/NADPH--P450 reductase OS=Bacillus megaterium GN=cyp102A1 PE=1 SV=2 | 123 | 473 | 2.0E-09 |
| sp|P15123|CP2CG_RABIT | Cytochrome P450 2C16 OS=Oryctolagus cuniculus GN=CYP2C16 PE=2 SV=1 | 199 | 462 | 2.0E-09 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0004497 | monooxygenase activity | Yes |
| GO:0016705 | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | Yes |
| GO:0005506 | iron ion binding | Yes |
| GO:0020037 | heme binding | Yes |
| GO:0016491 | oxidoreductase activity | No |
| GO:0046906 | tetrapyrrole binding | No |
| GO:0003824 | catalytic activity | No |
| GO:0046872 | metal ion binding | No |
| GO:0046914 | transition metal ion binding | No |
| GO:0097159 | organic cyclic compound binding | No |
| GO:0005488 | binding | No |
| GO:0043167 | ion binding | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0043169 | cation binding | No |
| GO:0003674 | molecular_function | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 11 | 0.5 |
| Domain # | Start | End | Length |
|---|---|---|---|
| 1 | 7 | 29 | 22 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|8824 MTQALDLFMYCIGLAVTYTGCLLLYNVWLHPLSKYPGPFLWRAFRFPFLSAFVRGRLPHEIKKLHEEYGDIVRLA PDELSFIDPAAWRDIYPKNFVRPYEYKDQPPGKTASNLIACTETEHARFRRILAPAFSERHTAAQEPFVCSYVDK LVSKLDERIEETSGRGSTDINAVEWINYLAFDVIGDLVWGSSFGCLDGLTSHPWIQAVSQFKAATIVTSAKFYPW LYATLMAITPSSALHEVMQMWRITEHKVRGRIAAGSDRPDIIGQLLASEKDPASESMIREEMEVNAMILVAAGSE SVTTVLTGLLNYLLRNPDDLAAVTGEIRAAFSSGDLIAGPKLKQLPILNATLNEGMRLCPTIPDAMRRNVPSGGA TVAGEMLPAGTVVSVPPWAAYRSRRNFVEPERFLPARWLGNADSGTRDDKTAFNPFSLGPHNCPGQNLAWLELRL ILAKLLWTFDVSVPPGVDLPVWEKQSIWWFWDKQPTFVRLTRRSSEAAGALYDQSTL* |
| Coding | >Hirsu2|8824 ATGACCCAAGCTTTGGACCTTTTCATGTACTGTATAGGCTTGGCGGTGACGTACACCGGCTGTCTGCTGCTGTAT AACGTCTGGCTTCATCCGCTTTCAAAATATCCAGGGCCATTTCTCTGGCGTGCTTTTCGGTTTCCTTTCCTTTCC GCCTTCGTCCGGGGACGGCTGCCTCACGAGATCAAGAAGCTGCATGAAGAATACGGCGACATTGTCCGGCTAGCT CCAGACGAGCTATCGTTCATTGATCCGGCCGCTTGGAGAGACATCTACCCGAAGAACTTCGTGCGCCCCTACGAG TATAAAGACCAGCCACCGGGAAAGACGGCGTCCAACTTGATTGCGTGCACCGAGACGGAACACGCCCGCTTTCGA AGAATTCTGGCACCGGCGTTCTCAGAGCGGCATACGGCAGCACAGGAACCTTTCGTCTGCTCTTATGTCGACAAA TTGGTTTCGAAGCTGGACGAGCGCATCGAGGAGACGTCGGGCCGTGGGTCGACCGACATAAATGCCGTCGAGTGG ATCAATTATTTGGCATTTGATGTCATTGGGGACTTGGTTTGGGGCTCTTCGTTCGGCTGTCTGGACGGTCTGACG AGTCATCCCTGGATCCAGGCCGTCAGTCAATTCAAGGCAGCGACGATAGTCACATCCGCCAAGTTCTATCCGTGG CTATACGCAACGCTCATGGCCATCACGCCGTCTTCTGCATTGCACGAGGTGATGCAGATGTGGCGGATCACTGAG CACAAGGTTCGCGGGCGGATTGCCGCCGGCTCGGACCGGCCCGACATTATCGGCCAGCTTCTGGCGTCCGAGAAG GATCCCGCATCTGAGTCCATGATTCGCGAAGAAATGGAGGTCAACGCTATGATACTGGTGGCTGCAGGTAGCGAA TCGGTCACAACAGTCTTGACCGGACTGCTCAACTACCTCCTGCGCAATCCGGACGACCTTGCTGCCGTCACTGGC GAGATCCGAGCGGCTTTCAGTTCCGGAGACTTGATCGCAGGGCCAAAGCTGAAGCAGCTTCCCATCCTCAACGCT ACCTTGAACGAGGGCATGAGGCTCTGCCCAACGATTCCCGACGCGATGCGCCGTAACGTTCCTTCCGGCGGAGCC ACCGTTGCTGGTGAAATGCTCCCTGCCGGCACGGTGGTCTCCGTCCCGCCATGGGCAGCCTACAGGTCCAGGCGA AACTTCGTGGAGCCGGAGCGCTTCCTGCCTGCGCGGTGGCTCGGCAACGCGGACAGCGGCACACGAGACGACAAG ACCGCCTTCAACCCGTTCTCGCTTGGCCCCCACAACTGCCCTGGGCAGAATCTGGCCTGGCTTGAGCTGCGGCTG ATCCTGGCCAAGTTGCTGTGGACGTTTGATGTTTCTGTTCCTCCGGGCGTTGACCTGCCGGTGTGGGAAAAGCAG AGCATCTGGTGGTTCTGGGATAAGCAGCCTACCTTTGTCCGTCTCACCCGTAGGAGCTCGGAGGCGGCTGGTGCA CTGTACGACCAATCAACACTCTGA |
| Transcript | >Hirsu2|8824 ATGACCCAAGCTTTGGACCTTTTCATGTACTGTATAGGCTTGGCGGTGACGTACACCGGCTGTCTGCTGCTGTAT AACGTCTGGCTTCATCCGCTTTCAAAATATCCAGGGCCATTTCTCTGGCGTGCTTTTCGGTTTCCTTTCCTTTCC GCCTTCGTCCGGGGACGGCTGCCTCACGAGATCAAGAAGCTGCATGAAGAATACGGCGACATTGTCCGGCTAGCT CCAGACGAGCTATCGTTCATTGATCCGGCCGCTTGGAGAGACATCTACCCGAAGAACTTCGTGCGCCCCTACGAG TATAAAGACCAGCCACCGGGAAAGACGGCGTCCAACTTGATTGCGTGCACCGAGACGGAACACGCCCGCTTTCGA AGAATTCTGGCACCGGCGTTCTCAGAGCGGCATACGGCAGCACAGGAACCTTTCGTCTGCTCTTATGTCGACAAA TTGGTTTCGAAGCTGGACGAGCGCATCGAGGAGACGTCGGGCCGTGGGTCGACCGACATAAATGCCGTCGAGTGG ATCAATTATTTGGCATTTGATGTCATTGGGGACTTGGTTTGGGGCTCTTCGTTCGGCTGTCTGGACGGTCTGACG AGTCATCCCTGGATCCAGGCCGTCAGTCAATTCAAGGCAGCGACGATAGTCACATCCGCCAAGTTCTATCCGTGG CTATACGCAACGCTCATGGCCATCACGCCGTCTTCTGCATTGCACGAGGTGATGCAGATGTGGCGGATCACTGAG CACAAGGTTCGCGGGCGGATTGCCGCCGGCTCGGACCGGCCCGACATTATCGGCCAGCTTCTGGCGTCCGAGAAG GATCCCGCATCTGAGTCCATGATTCGCGAAGAAATGGAGGTCAACGCTATGATACTGGTGGCTGCAGGTAGCGAA TCGGTCACAACAGTCTTGACCGGACTGCTCAACTACCTCCTGCGCAATCCGGACGACCTTGCTGCCGTCACTGGC GAGATCCGAGCGGCTTTCAGTTCCGGAGACTTGATCGCAGGGCCAAAGCTGAAGCAGCTTCCCATCCTCAACGCT ACCTTGAACGAGGGCATGAGGCTCTGCCCAACGATTCCCGACGCGATGCGCCGTAACGTTCCTTCCGGCGGAGCC ACCGTTGCTGGTGAAATGCTCCCTGCCGGCACGGTGGTCTCCGTCCCGCCATGGGCAGCCTACAGGTCCAGGCGA AACTTCGTGGAGCCGGAGCGCTTCCTGCCTGCGCGGTGGCTCGGCAACGCGGACAGCGGCACACGAGACGACAAG ACCGCCTTCAACCCGTTCTCGCTTGGCCCCCACAACTGCCCTGGGCAGAATCTGGCCTGGCTTGAGCTGCGGCTG ATCCTGGCCAAGTTGCTGTGGACGTTTGATGTTTCTGTTCCTCCGGGCGTTGACCTGCCGGTGTGGGAAAAGCAG AGCATCTGGTGGTTCTGGGATAAGCAGCCTACCTTTGTCCGTCTCACCCGTAGGAGCTCGGAGGCGGCTGGTGCA CTGTACGACCAATCAACACTCTGA |
| Gene | >Hirsu2|8824 ATGACCCAAGCTTTGGACCTTTTCATGTACTGTATAGGCTTGGCGGTGACGGTGAGTCCAACACAGGCATAGCAT CTGCTTTTAGGTGCGGTCTAACGAACACGCTGCAGTACACCGGCTGTCTGCTGCTGTATAACGTCTGGCTTCATC CGCTTTCAAAATATCCAGGGCCATTTCTCTGGCGTGCTTTTCGGTTTCCTTTCCTTTCCGCCTTCGTCCGGGGAC GGCTGCCTCACGAGATCAAGAAGCTGCATGAAGAATACGGCGACATTGTCCGGCTAGCTCCAGACGAGCTATCGT TCATTGATCCGGCCGCTTGGAGAGACATCTACCCGAAGAACTTCGTGCGCCCCTACGAGTATAAAGACCAGCCAC CGGGAAAGACGGCGTCCAACTTGATTGCGTGCACCGAGACGGAACACGCCCGCTTTCGAAGAATTCTGGCACCGG CGTTCTCAGAGCGGCATACGGCAGCACAGGAACCTTTCGTCTGCTCTTATGTCGACAAATTGGTTTCGAAGCTGG ACGAGCGCATCGAGGAGACGTCGGGCCGTGGGTCGACCGACATAAATGCCGTCGAGTGGATCAATTATTTGGCAT TTGATGTCATTGGGGACTTGGTTTGGGGCTCTTCGTTCGGCTGTCTGGACGGTCTGACGAGTCATCCCTGGATCC AGGCCGTCAGTCAATTCAAGGCAGCGACGATAGTCACATCCGCCAAGTTCTATCCGTGGCTATACGCAACGCTCA TGGCCATCACGCCGTCTTCTGCATTGCACGAGGTGATGCAGATGTGGCGGATCACTGAGCACAAGGTTCGCGGGC GGATTGCCGCCGGCTCGGACCGGCCCGACATTATCGGCCAGCTTCTGGCGTCCGAGAAGGATCCCGCATCTGAGT CCATGATTCGCGAAGAAATGGAGGTCAACGCTATGATACTGGTGGCTGCAGGTAGCGAATCGGTCACAACAGTCT TGACCGGACTGCTCAACTACCTCCTGCGCAATCCGGACGACCTTGCTGCCGTCACTGGCGAGATCCGAGCGGCTT TCAGTTCCGGAGACTTGATCGCAGGGCCAAAGCTGAAGCAGCTTCCCATCCTCAACGCTACCTTGAACGAGGGCA TGAGGCTCTGCCCAACGATTCCCGACGCGATGCGCCGTAACGTTCCTTCCGGCGGAGCCACCGTTGCTGGTGAAA TGCTCCCTGCCGGCACGGTGGTCTCCGTCCCGCCATGGGCAGCCTACAGGTCCAGGCGAAACTTCGTGGAGCCGG AGCGCTTCCTGCCTGCGCGGTGGCTCGGCAACGCGGACAGCGGCACACGAGACGACAAGACCGCCTTCAACCCGT TCTCGCTTGGCCCCCACAACTGCCCTGGGCAGAATCTGGCCTGGCTTGAGCTGCGGCTGATCCTGGCCAAGTTGC TGTGGACGTTTGATGTTTCTGTTCCTCCGGGCGTTGACCTGCCGGTGTGGGAAAAGCAGAGCATCTGGTGGTTCT GGGATAAGCAGCCTACCTTTGTCCGTCTCACCCGTAGGAGCTCGGAGGCGGCTGGTGCACTGTACGACCAATCAA CACTCTGA |