Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|882
Gene name
LocationContig_1185:21..411
Strand+
Gene length (bp)390
Transcript length (bp)333
Coding sequence length (bp)333
Protein length (aa) 111

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05686 Glyco_transf_90 Glycosyl transferase family 90 1.0E-11 4 87

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5K8R6|CXT1_CRYNJ Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CXT1 PE=1 SV=1 1 91 6.0E-13
sp|Q6UW63|KDEL1_HUMAN KDEL motif-containing protein 1 OS=Homo sapiens GN=KDELC1 PE=1 SV=1 5 86 1.0E-07
sp|Q29AU6|RUMI_DROPS O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura GN=rumi PE=3 SV=1 1 87 2.0E-07
sp|Q9JHP7|KDEL1_MOUSE KDEL motif-containing protein 1 OS=Mus musculus GN=Kdelc1 PE=1 SV=1 5 86 2.0E-06
sp|Q566E5|KDEL2_RAT KDEL motif-containing protein 2 OS=Rattus norvegicus GN=Kdelc2 PE=2 SV=1 1 84 3.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|882
MRSRSLALKQTLFREWHLDRLRPWVHYVPLSQEADELVEAVRFLDGDGRAEAERMAAQGRDWAARALRREDMEAW
FFRLLLEYARVVDDRRASLGFDMDAAETEHGPEQQ*
Coding >Hirsu2|882
ATGCGCAGCCGCAGCCTGGCGCTCAAGCAGACGCTGTTCCGCGAGTGGCACCTGGACCGGCTGCGGCCGTGGGTC
CACTACGTGCCGCTGAGCCAGGAGGCCGACGAGCTGGTCGAGGCCGTGCGCTTCCTCGACGGCGACGGCCGCGCC
GAGGCCGAGCGCATGGCCGCCCAGGGCCGCGACTGGGCCGCCCGCGCGCTGCGCCGCGAGGACATGGAGGCCTGG
TTCTTCCGCCTGCTTCTCGAGTACGCGCGCGTCGTCGACGATCGGAGGGCGAGCCTCGGCTTCGACATGGACGCG
GCCGAGACCGAGCACGGGCCCGAACAGCAGTGA
Transcript >Hirsu2|882
ATGCGCAGCCGCAGCCTGGCGCTCAAGCAGACGCTGTTCCGCGAGTGGCACCTGGACCGGCTGCGGCCGTGGGTC
CACTACGTGCCGCTGAGCCAGGAGGCCGACGAGCTGGTCGAGGCCGTGCGCTTCCTCGACGGCGACGGCCGCGCC
GAGGCCGAGCGCATGGCCGCCCAGGGCCGCGACTGGGCCGCCCGCGCGCTGCGCCGCGAGGACATGGAGGCCTGG
TTCTTCCGCCTGCTTCTCGAGTACGCGCGCGTCGTCGACGATCGGAGGGCGAGCCTCGGCTTCGACATGGACGCG
GCCGAGACCGAGCACGGGCCCGAACAGCAGTGA
Gene >Hirsu2|882
ATGCGCAGCCGCAGCCTGGCGCTCAAGCAGACGCTGTTCCGCGAGTGGCACCTGGACCGGCTGCGGCCGTGGGTC
CACTACGTGCCGCTGAGCCAGGAGGCCGACGAGCTGGTCGAGGCCGTGCGCTTCCTCGACGGCGACGGCCGCGCC
GAGGCCGAGCGCATGGCCGCCCAGGGCCGCGACTGGGCCGCCCGCGCGCTGCGCCGCGAGGACATGGAGGCCTGG
TTCTTCCGCCTGCTTCTCGAGTGAGTCCCCGGCTCCTTTTTGACCCCGCGCCGTCCCGGCCGTTGACCGGCCGAC
AGGTACGCGCGCGTCGTCGACGATCGGAGGGCGAGCCTCGGCTTCGACATGGACGCGGCCGAGACCGAGCACGGG
CCCGAACAGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail