Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8803
Gene name
LocationContig_6:57700..58771
Strand+
Gene length (bp)1071
Transcript length (bp)1071
Coding sequence length (bp)1071
Protein length (aa) 357

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 1.5E-11 218 331

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P32329|YPS1_YEAST Aspartic proteinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS1 PE=1 SV=2 218 344 4.0E-07
sp|Q12303|YPS3_YEAST Aspartic proteinase yapsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS3 PE=1 SV=1 218 354 1.0E-06
sp|P12630|BAR1_YEAST Barrierpepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAR1 PE=1 SV=1 219 338 4.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8803
MAKIDGPLMEVPLVPTPPELLGDSEDDDRENEVDKDGNGENKGKDGGDGNKKDGGNGKKPGGGGGGGGGDKPGKN
NRLRRVRRVRRRSIFRRNGKDNNKNQDAKNKNGDKNGQGGQADEESKGNNGNQNSKGGKKATEFVVDLTSVAFVP
GKDANAGGQNGGGGSSSGKKQANNKRNEGGKDRGGKTEGGNAGGSGQGDAKSGQNGGVVDLTPKEGLIPALVDTG
NPENSIPGPVLQNLAKALGADFNDEEGFVEPFDCSKINGASMRFTFNKNAIIDVPLEMMLIPEKITGEKTCDLAM
TASDAISLGSPFMQAAYIVFDSGNKRMLLGQAVINTTESAVEQVGKDCKPKTMRTG*
Coding >Hirsu2|8803
ATGGCCAAGATCGATGGACCGCTTATGGAGGTGCCCCTTGTACCAACACCCCCTGAGCTTTTAGGGGATAGCGAG
GACGACGACAGGGAGAACGAGGTGGATAAGGACGGCAACGGAGAAAACAAAGGAAAAGATGGCGGGGACGGGAAT
AAGAAAGATGGCGGGAACGGGAAAAAGCCAGGCGGCGGCGGCGGCGGCGGCGGCGGTGACAAGCCCGGCAAGAAC
AATAGACTCAGGCGGGTTCGGAGGGTCAGGAGAAGATCCATCTTCAGGAGAAACGGCAAAGATAACAACAAGAAT
CAAGACGCGAAAAACAAAAACGGCGACAAGAACGGCCAAGGGGGCCAAGCCGACGAGGAGTCCAAAGGCAACAAC
GGCAACCAAAACTCCAAAGGCGGCAAGAAGGCCACCGAGTTCGTCGTCGACTTGACCTCGGTTGCTTTCGTCCCC
GGCAAGGACGCCAATGCAGGCGGCCAAAACGGCGGGGGCGGAAGCAGTTCTGGCAAGAAACAGGCGAACAACAAG
CGGAATGAAGGCGGCAAAGACCGAGGAGGCAAGACTGAAGGCGGAAACGCGGGCGGGTCCGGCCAAGGAGACGCC
AAGTCCGGCCAAAACGGAGGCGTCGTGGACCTTACGCCAAAGGAGGGCCTGATTCCGGCCCTGGTGGACACGGGC
AACCCCGAGAACTCGATCCCCGGACCGGTGCTACAGAACCTGGCCAAGGCGCTGGGAGCCGACTTCAACGACGAG
GAGGGCTTCGTGGAGCCCTTCGACTGCAGCAAGATCAACGGCGCCAGCATGCGGTTCACCTTCAACAAAAATGCC
ATAATCGACGTGCCGCTCGAGATGATGCTGATTCCGGAGAAGATCACGGGCGAGAAAACGTGTGACCTGGCCATG
ACGGCGTCCGACGCCATCAGCCTCGGCTCTCCCTTCATGCAGGCCGCCTACATCGTCTTCGACTCCGGCAACAAA
CGCATGTTACTCGGCCAGGCCGTCATCAACACTACCGAGTCAGCAGTAGAACAGGTGGGCAAGGATTGTAAGCCG
AAAACGATGCGCACTGGCTAG
Transcript >Hirsu2|8803
ATGGCCAAGATCGATGGACCGCTTATGGAGGTGCCCCTTGTACCAACACCCCCTGAGCTTTTAGGGGATAGCGAG
GACGACGACAGGGAGAACGAGGTGGATAAGGACGGCAACGGAGAAAACAAAGGAAAAGATGGCGGGGACGGGAAT
AAGAAAGATGGCGGGAACGGGAAAAAGCCAGGCGGCGGCGGCGGCGGCGGCGGCGGTGACAAGCCCGGCAAGAAC
AATAGACTCAGGCGGGTTCGGAGGGTCAGGAGAAGATCCATCTTCAGGAGAAACGGCAAAGATAACAACAAGAAT
CAAGACGCGAAAAACAAAAACGGCGACAAGAACGGCCAAGGGGGCCAAGCCGACGAGGAGTCCAAAGGCAACAAC
GGCAACCAAAACTCCAAAGGCGGCAAGAAGGCCACCGAGTTCGTCGTCGACTTGACCTCGGTTGCTTTCGTCCCC
GGCAAGGACGCCAATGCAGGCGGCCAAAACGGCGGGGGCGGAAGCAGTTCTGGCAAGAAACAGGCGAACAACAAG
CGGAATGAAGGCGGCAAAGACCGAGGAGGCAAGACTGAAGGCGGAAACGCGGGCGGGTCCGGCCAAGGAGACGCC
AAGTCCGGCCAAAACGGAGGCGTCGTGGACCTTACGCCAAAGGAGGGCCTGATTCCGGCCCTGGTGGACACGGGC
AACCCCGAGAACTCGATCCCCGGACCGGTGCTACAGAACCTGGCCAAGGCGCTGGGAGCCGACTTCAACGACGAG
GAGGGCTTCGTGGAGCCCTTCGACTGCAGCAAGATCAACGGCGCCAGCATGCGGTTCACCTTCAACAAAAATGCC
ATAATCGACGTGCCGCTCGAGATGATGCTGATTCCGGAGAAGATCACGGGCGAGAAAACGTGTGACCTGGCCATG
ACGGCGTCCGACGCCATCAGCCTCGGCTCTCCCTTCATGCAGGCCGCCTACATCGTCTTCGACTCCGGCAACAAA
CGCATGTTACTCGGCCAGGCCGTCATCAACACTACCGAGTCAGCAGTAGAACAGGTGGGCAAGGATTGTAAGCCG
AAAACGATGCGCACTGGCTAG
Gene >Hirsu2|8803
ATGGCCAAGATCGATGGACCGCTTATGGAGGTGCCCCTTGTACCAACACCCCCTGAGCTTTTAGGGGATAGCGAG
GACGACGACAGGGAGAACGAGGTGGATAAGGACGGCAACGGAGAAAACAAAGGAAAAGATGGCGGGGACGGGAAT
AAGAAAGATGGCGGGAACGGGAAAAAGCCAGGCGGCGGCGGCGGCGGCGGCGGCGGTGACAAGCCCGGCAAGAAC
AATAGACTCAGGCGGGTTCGGAGGGTCAGGAGAAGATCCATCTTCAGGAGAAACGGCAAAGATAACAACAAGAAT
CAAGACGCGAAAAACAAAAACGGCGACAAGAACGGCCAAGGGGGCCAAGCCGACGAGGAGTCCAAAGGCAACAAC
GGCAACCAAAACTCCAAAGGCGGCAAGAAGGCCACCGAGTTCGTCGTCGACTTGACCTCGGTTGCTTTCGTCCCC
GGCAAGGACGCCAATGCAGGCGGCCAAAACGGCGGGGGCGGAAGCAGTTCTGGCAAGAAACAGGCGAACAACAAG
CGGAATGAAGGCGGCAAAGACCGAGGAGGCAAGACTGAAGGCGGAAACGCGGGCGGGTCCGGCCAAGGAGACGCC
AAGTCCGGCCAAAACGGAGGCGTCGTGGACCTTACGCCAAAGGAGGGCCTGATTCCGGCCCTGGTGGACACGGGC
AACCCCGAGAACTCGATCCCCGGACCGGTGCTACAGAACCTGGCCAAGGCGCTGGGAGCCGACTTCAACGACGAG
GAGGGCTTCGTGGAGCCCTTCGACTGCAGCAAGATCAACGGCGCCAGCATGCGGTTCACCTTCAACAAAAATGCC
ATAATCGACGTGCCGCTCGAGATGATGCTGATTCCGGAGAAGATCACGGGCGAGAAAACGTGTGACCTGGCCATG
ACGGCGTCCGACGCCATCAGCCTCGGCTCTCCCTTCATGCAGGCCGCCTACATCGTCTTCGACTCCGGCAACAAA
CGCATGTTACTCGGCCAGGCCGTCATCAACACTACCGAGTCAGCAGTAGAACAGGTGGGCAAGGATTGTAAGCCG
AAAACGATGCGCACTGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail