Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|880
Gene name
LocationContig_1184:4225..5501
Strand+
Gene length (bp)1276
Transcript length (bp)906
Coding sequence length (bp)906
Protein length (aa) 302

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03947 Ribosomal_L2_C Ribosomal Proteins L2, C-terminal domain 3.2E-41 145 271
PF00181 Ribosomal_L2 Ribosomal Proteins L2, RNA binding domain 2.0E-13 58 136

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q75AP7|RL2_ASHGO 60S ribosomal protein L2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPL2 PE=4 SV=1 48 301 3.0E-136
sp|Q6FPN7|RL2_CANGA 60S ribosomal protein L2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPL2 PE=4 SV=1 48 301 7.0E-136
sp|P0CX46|RL2B_YEAST 60S ribosomal protein L2-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL2B PE=1 SV=1 48 301 2.0E-134
sp|P0CX45|RL2A_YEAST 60S ribosomal protein L2-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL2A PE=1 SV=1 48 301 2.0E-134
sp|Q95V39|RL8_SPOFR 60S ribosomal protein L8 OS=Spodoptera frugiperda GN=RpL8 PE=2 SV=1 48 295 1.0E-126
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q75AP7|RL2_ASHGO 60S ribosomal protein L2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPL2 PE=4 SV=1 48 301 3.0E-136
sp|Q6FPN7|RL2_CANGA 60S ribosomal protein L2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPL2 PE=4 SV=1 48 301 7.0E-136
sp|P0CX46|RL2B_YEAST 60S ribosomal protein L2-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL2B PE=1 SV=1 48 301 2.0E-134
sp|P0CX45|RL2A_YEAST 60S ribosomal protein L2-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL2A PE=1 SV=1 48 301 2.0E-134
sp|Q95V39|RL8_SPOFR 60S ribosomal protein L8 OS=Spodoptera frugiperda GN=RpL8 PE=2 SV=1 48 295 1.0E-126
sp|Q6RYS3|RL8_MAMBR 60S ribosomal protein L8 OS=Mamestra brassicae GN=RpL8 PE=2 SV=1 48 295 1.0E-126
sp|P0CT72|RL2C_SCHPO 60S ribosomal protein L2-C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl803 PE=3 SV=1 48 295 1.0E-125
sp|P0CT71|RL2B_SCHPO 60S ribosomal protein L2-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl802 PE=3 SV=1 48 295 1.0E-125
sp|P0CT70|RL2A_SCHPO 60S ribosomal protein L2-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl801 PE=3 SV=1 48 295 1.0E-125
sp|Q9U9L2|RL8_ANOGA 60S ribosomal protein L8 OS=Anopheles gambiae GN=RpL8 PE=2 SV=2 48 295 2.0E-125
sp|P29766|RL8_SOLLC 60S ribosomal protein L8 OS=Solanum lycopersicum GN=RPL8 PE=2 SV=1 48 298 2.0E-125
sp|Q6PBF0|RL8_XENTR 60S ribosomal protein L8 OS=Xenopus tropicalis GN=rpl8 PE=2 SV=3 48 301 4.0E-124
sp|Q42064|RL83_ARATH 60S ribosomal protein L8-3 OS=Arabidopsis thaliana GN=RPL8C PE=1 SV=2 48 295 8.0E-124
sp|P46286|RL81_ARATH 60S ribosomal protein L8-1 OS=Arabidopsis thaliana GN=RPL8A PE=1 SV=2 48 295 9.0E-124
sp|P41569|RL8_AEDAL 60S ribosomal protein L8 OS=Aedes albopictus GN=RpL8 PE=3 SV=1 48 295 1.0E-123
sp|P41116|RL8_XENLA 60S ribosomal protein L8 OS=Xenopus laevis GN=rpl8 PE=2 SV=3 48 301 2.0E-123
sp|Q9V3G1|RL8_DROME 60S ribosomal protein L8 OS=Drosophila melanogaster GN=RpL8 PE=1 SV=1 48 295 2.0E-122
sp|P25998|RL8_TOBAC 60S ribosomal protein L8 OS=Nicotiana tabacum GN=RPL8 PE=2 SV=1 48 295 2.0E-122
sp|P13023|RL8_DICDI 60S ribosomal protein L8 OS=Dictyostelium discoideum GN=rpl8 PE=1 SV=2 48 301 3.0E-117
sp|P62919|RL8_RAT 60S ribosomal protein L8 OS=Rattus norvegicus GN=Rpl8 PE=2 SV=2 48 301 1.0E-116
sp|P62918|RL8_MOUSE 60S ribosomal protein L8 OS=Mus musculus GN=Rpl8 PE=1 SV=2 48 301 1.0E-116
sp|P62917|RL8_HUMAN 60S ribosomal protein L8 OS=Homo sapiens GN=RPL8 PE=1 SV=2 48 301 1.0E-116
sp|Q3T0S6|RL8_BOVIN 60S ribosomal protein L8 OS=Bos taurus GN=RPL8 PE=2 SV=3 48 301 1.0E-116
sp|Q6P0V6|RL8_DANRE 60S ribosomal protein L8 OS=Danio rerio GN=rpl8 PE=2 SV=3 48 301 2.0E-116
sp|Q5R7Y8|RL8_PONAB 60S ribosomal protein L8 OS=Pongo abelii GN=RPL8 PE=2 SV=3 48 301 3.0E-116
sp|Q90YW1|RL8_ICTPU 60S ribosomal protein L8 OS=Ictalurus punctatus GN=rpl8 PE=2 SV=3 48 301 3.0E-116
sp|Q9XVF7|RL8_CAEEL 60S ribosomal protein L8 OS=Caenorhabditis elegans GN=rpl-8 PE=3 SV=1 48 300 6.0E-116
sp|P0DJ52|RL8_TETTS 60S ribosomal protein L8 OS=Tetrahymena thermophila (strain SB210) GN=RPL8 PE=1 SV=1 48 298 1.0E-111
sp|Q4PSL7|RL82_ARATH 60S ribosomal protein L8-2 OS=Arabidopsis thaliana GN=RPL8B PE=2 SV=3 48 285 2.0E-111
sp|A4FVX9|RL2_METM5 50S ribosomal protein L2 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl2 PE=3 SV=1 48 291 6.0E-65
sp|A6VHD5|RL2_METM7 50S ribosomal protein L2 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl2 PE=3 SV=1 48 291 1.0E-64
sp|Q6LX08|RL2_METMP 50S ribosomal protein L2 OS=Methanococcus maripaludis (strain S2 / LL) GN=rpl2 PE=3 SV=1 48 291 2.0E-64
sp|A9A9B5|RL2_METM6 50S ribosomal protein L2 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpl2 PE=3 SV=1 48 291 3.0E-64
sp|Q9YFN1|RL2_AERPE 50S ribosomal protein L2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpl2 PE=3 SV=1 48 291 8.0E-63
sp|A3DNA7|RL2_STAMF 50S ribosomal protein L2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rpl2 PE=3 SV=1 48 295 1.0E-62
sp|A6UQJ3|RL2_METVS 50S ribosomal protein L2 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpl2 PE=3 SV=1 48 291 2.0E-62
sp|P21479|RL2_METVA 50S ribosomal protein L2 OS=Methanococcus vannielii GN=rpl2 PE=3 SV=1 48 290 6.0E-62
sp|B8D5W9|RL2_DESK1 50S ribosomal protein L2 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=rpl2 PE=3 SV=1 48 295 2.0E-61
sp|A6UV65|RL2_META3 50S ribosomal protein L2 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpl2 PE=3 SV=1 48 291 3.0E-60
sp|A2BMB2|RL2_HYPBU 50S ribosomal protein L2 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rpl2 PE=3 SV=1 48 291 2.0E-58
sp|P54017|RL2_METJA 50S ribosomal protein L2 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl2 PE=3 SV=2 48 292 3.0E-58
sp|Q8U001|RL2_PYRFU 50S ribosomal protein L2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpl2 PE=1 SV=1 48 291 4.0E-58
sp|O26113|RL2_METTH 50S ribosomal protein L2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl2 PE=3 SV=1 48 294 7.0E-58
sp|Q2NFV9|RL2_METST 50S ribosomal protein L2 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rpl2 PE=3 SV=1 48 294 7.0E-57
sp|B1L707|RL2_KORCO 50S ribosomal protein L2 OS=Korarchaeum cryptofilum (strain OPF8) GN=rpl2 PE=3 SV=1 48 300 2.0E-56
sp|Q9V1T8|RL2_PYRAB 50S ribosomal protein L2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpl2 PE=3 SV=1 48 291 6.0E-56
sp|A5UL86|RL2_METS3 50S ribosomal protein L2 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rpl2 PE=3 SV=1 48 294 2.0E-55
sp|O59421|RL2_PYRHO 50S ribosomal protein L2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpl2 PE=3 SV=1 48 291 3.0E-55
sp|C5A283|RL2_THEGJ 50S ribosomal protein L2 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rpl2 PE=3 SV=1 48 291 8.0E-55
sp|Q5JDH2|RL2_THEKO 50S ribosomal protein L2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpl2 PE=3 SV=1 48 291 8.0E-55
sp|Q8SSM6|RL8_ENCCU 60S ribosomal protein L8 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPL8 PE=3 SV=1 48 298 1.0E-53
sp|Q46G98|RL2_METBF 50S ribosomal protein L2 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rpl2 PE=3 SV=1 48 294 2.0E-53
sp|Q8PV47|RL2_METMA 50S ribosomal protein L2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpl2 PE=3 SV=1 48 294 3.0E-53
sp|A3MS41|RL2_PYRCJ 50S ribosomal protein L2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rpl2 PE=3 SV=1 48 291 1.0E-52
sp|O28357|RL2_ARCFU 50S ribosomal protein L2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpl2 PE=3 SV=1 48 294 1.0E-52
sp|Q9UXA5|RL2_SULSO 50S ribosomal protein L2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpl2 PE=3 SV=1 48 291 3.0E-52
sp|Q8TRU4|RL2_METAC 50S ribosomal protein L2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rpl2 PE=3 SV=1 48 294 7.0E-52
sp|Q8ZYF5|RL2_PYRAE 50S ribosomal protein L2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rpl2 PE=3 SV=1 48 291 1.0E-51
sp|A0B9W7|RL2_METTP 50S ribosomal protein L2 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rpl2 PE=3 SV=1 48 291 2.0E-51
sp|A4WH02|RL2_PYRAR 50S ribosomal protein L2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rpl2 PE=3 SV=1 48 291 4.0E-51
sp|A8AC70|RL2_IGNH4 50S ribosomal protein L2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rpl2 PE=3 SV=1 48 300 6.0E-51
sp|Q0W1Y6|RL2_METAR 50S ribosomal protein L2 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rpl2 PE=3 SV=1 48 292 2.0E-50
sp|Q8TY93|RL2_METKA 50S ribosomal protein L2 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl2 PE=3 SV=1 48 291 3.0E-50
sp|Q12ZU8|RL2_METBU 50S ribosomal protein L2 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rpl2 PE=3 SV=1 48 291 5.0E-50
sp|Q3IMY5|RL2_NATPD 50S ribosomal protein L2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rpl2 PE=3 SV=1 48 287 6.0E-50
sp|B6YSL6|RL2_THEON 50S ribosomal protein L2 OS=Thermococcus onnurineus (strain NA1) GN=rpl2 PE=3 SV=1 48 291 3.0E-49
sp|A1RTI4|RL2_PYRIL 50S ribosomal protein L2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rpl2 PE=3 SV=1 48 291 2.0E-48
sp|B1YA33|RL2_PYRNV 50S ribosomal protein L2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rpl2 PE=3 SV=1 48 291 2.0E-48
sp|P20276|RL2_HALMA 50S ribosomal protein L2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl2 PE=1 SV=4 61 291 6.0E-48
sp|A1RWQ7|RL2_THEPD 50S ribosomal protein L2 OS=Thermofilum pendens (strain Hrk 5) GN=rpl2 PE=3 SV=1 48 299 7.0E-48
sp|A4YCW9|RL2_METS5 50S ribosomal protein L2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rpl2 PE=3 SV=1 48 291 2.0E-47
sp|Q4JB43|RL2_SULAC 50S ribosomal protein L2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpl2 PE=3 SV=1 48 291 2.0E-47
sp|C3NEE6|RL2_SULIY 50S ribosomal protein L2 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rpl2 PE=3 SV=1 48 291 3.0E-47
sp|C3MVI1|RL2_SULIM 50S ribosomal protein L2 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rpl2 PE=3 SV=1 48 291 3.0E-47
sp|C3MQ62|RL2_SULIL 50S ribosomal protein L2 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rpl2 PE=3 SV=1 48 291 3.0E-47
sp|C4KHF9|RL2_SULIK 50S ribosomal protein L2 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rpl2 PE=3 SV=1 48 291 3.0E-47
sp|C3N5T0|RL2_SULIA 50S ribosomal protein L2 OS=Sulfolobus islandicus (strain M.16.27) GN=rpl2 PE=3 SV=1 48 291 3.0E-47
sp|Q9HPD1|RL2_HALSA 50S ribosomal protein L2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpl2 PE=3 SV=3 83 291 1.0E-46
sp|B0R659|RL2_HALS3 50S ribosomal protein L2 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpl2 PE=3 SV=1 83 291 1.0E-46
sp|C3NHA6|RL2_SULIN 50S ribosomal protein L2 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rpl2 PE=3 SV=1 48 291 2.0E-46
sp|Q18GF2|RL2_HALWD 50S ribosomal protein L2 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rpl2 PE=3 SV=1 61 291 3.0E-46
sp|A2SPK6|RL2_METLZ 50S ribosomal protein L2 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rpl2 PE=3 SV=1 48 294 2.0E-45
sp|B9LSS4|RL2_HALLT 50S ribosomal protein L2 OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rpl2 PE=3 SV=1 63 298 3.0E-45
sp|Q975I4|RL2_SULTO 50S ribosomal protein L2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpl2 PE=3 SV=2 48 291 5.0E-45
sp|O15574|RL8_ENTHI 60S ribosomal protein L8 (Fragment) OS=Entamoeba histolytica GN=RPL8 PE=2 SV=1 89 202 1.0E-44
sp|A0RZ09|RL2_CENSY 50S ribosomal protein L2 OS=Cenarchaeum symbiosum (strain A) GN=rpl2 PE=3 SV=1 48 291 9.0E-41
sp|Q2FU94|RL2_METHJ 50S ribosomal protein L2 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rpl2 PE=3 SV=1 94 291 1.0E-40
sp|A9A141|RL2_NITMS 50S ribosomal protein L2 OS=Nitrosopumilus maritimus (strain SCM1) GN=rpl2 PE=3 SV=1 48 294 2.0E-40
sp|A3CT00|RL2_METMJ 50S ribosomal protein L2 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rpl2 PE=3 SV=1 50 291 1.0E-39
sp|A7I5P2|RL2_METB6 50S ribosomal protein L2 OS=Methanoregula boonei (strain 6A8) GN=rpl2 PE=3 SV=1 48 294 3.0E-38
sp|A8ME99|RL2_CALMQ 50S ribosomal protein L2 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rpl2 PE=3 SV=1 48 291 5.0E-37
sp|Q97BX4|RL2_THEVO 50S ribosomal protein L2 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rpl2 PE=3 SV=1 48 289 2.0E-36
sp|B8GKD6|RL2_METPE 50S ribosomal protein L2 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=rpl2 PE=3 SV=1 48 291 3.0E-36
sp|Q9HIR2|RL2_THEAC 50S ribosomal protein L2 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpl2 PE=3 SV=1 48 289 8.0E-35
sp|P60408|RL2_NANEQ 50S ribosomal protein L2 OS=Nanoarchaeum equitans (strain Kin4-M) GN=rpl2 PE=3 SV=1 48 291 4.0E-33
sp|Q6L1C4|RL2_PICTO 50S ribosomal protein L2 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rpl2 PE=3 SV=1 48 289 1.0E-31
sp|A5IYY3|RL2_MYCAP 50S ribosomal protein L2 OS=Mycoplasma agalactiae (strain PG2) GN=rplB PE=3 SV=1 76 290 5.0E-25
sp|Q98PY4|RL2_MYCPU 50S ribosomal protein L2 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rplB PE=3 SV=1 1 282 1.0E-24
sp|Q4A8H4|RL2_MYCH7 50S ribosomal protein L2 OS=Mycoplasma hyopneumoniae (strain 7448) GN=rplB PE=3 SV=1 75 282 1.0E-24
sp|Q601L2|RL2_MYCH2 50S ribosomal protein L2 OS=Mycoplasma hyopneumoniae (strain 232) GN=rplB PE=3 SV=1 75 282 1.0E-24
sp|Q3SSW3|RL2_NITWN 50S ribosomal protein L2 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rplB PE=3 SV=1 76 258 2.0E-24
sp|Q4AAE3|RL2_MYCHJ 50S ribosomal protein L2 OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=rplB PE=3 SV=1 75 282 4.0E-24
sp|Q9CDW5|RL2_LACLA 50S ribosomal protein L2 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rplB PE=3 SV=1 75 275 8.0E-24
sp|C6DG71|RL2_PECCP 50S ribosomal protein L2 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rplB PE=3 SV=1 75 268 9.0E-24
sp|Q02W27|RL2_LACLS 50S ribosomal protein L2 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rplB PE=3 SV=1 75 275 1.0E-23
sp|A2RNQ2|RL2_LACLM 50S ribosomal protein L2 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rplB PE=3 SV=1 75 275 1.0E-23
sp|Q1QN27|RL2_NITHX 50S ribosomal protein L2 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rplB PE=3 SV=1 76 258 1.0E-23
sp|Q2NQM5|RL2_SODGM 50S ribosomal protein L2 OS=Sodalis glossinidius (strain morsitans) GN=rplB PE=3 SV=1 76 268 2.0E-23
sp|Q6CZX3|RL2_PECAS 50S ribosomal protein L2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rplB PE=3 SV=1 76 268 2.0E-23
sp|C5BGM2|RL2_EDWI9 50S ribosomal protein L2 OS=Edwardsiella ictaluri (strain 93-146) GN=rplB PE=3 SV=1 75 268 3.0E-23
sp|A6TEW9|RL2_KLEP7 50S ribosomal protein L2 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rplB PE=3 SV=1 76 268 4.0E-23
sp|B5XN97|RL2_KLEP3 50S ribosomal protein L2 OS=Klebsiella pneumoniae (strain 342) GN=rplB PE=3 SV=1 76 268 4.0E-23
sp|P60428|RL2_SALTY 50S ribosomal protein L2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rplB PE=3 SV=1 76 268 4.0E-23
sp|P60427|RL2_SALTI 50S ribosomal protein L2 OS=Salmonella typhi GN=rplB PE=3 SV=1 76 268 4.0E-23
sp|B4TXD9|RL2_SALSV 50S ribosomal protein L2 OS=Salmonella schwarzengrund (strain CVM19633) GN=rplB PE=3 SV=1 76 268 4.0E-23
sp|B5BGY3|RL2_SALPK 50S ribosomal protein L2 OS=Salmonella paratyphi A (strain AKU_12601) GN=rplB PE=3 SV=1 76 268 4.0E-23
sp|A9MSZ5|RL2_SALPB 50S ribosomal protein L2 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rplB PE=3 SV=1 76 268 4.0E-23
sp|Q5PIV5|RL2_SALPA 50S ribosomal protein L2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rplB PE=3 SV=1 76 268 4.0E-23
sp|B4SUT7|RL2_SALNS 50S ribosomal protein L2 OS=Salmonella newport (strain SL254) GN=rplB PE=3 SV=1 76 268 4.0E-23
sp|B4TKL2|RL2_SALHS 50S ribosomal protein L2 OS=Salmonella heidelberg (strain SL476) GN=rplB PE=3 SV=1 76 268 4.0E-23
sp|B5RH18|RL2_SALG2 50S ribosomal protein L2 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rplB PE=3 SV=1 76 268 4.0E-23
sp|B5R288|RL2_SALEP 50S ribosomal protein L2 OS=Salmonella enteritidis PT4 (strain P125109) GN=rplB PE=3 SV=1 76 268 4.0E-23
sp|B5FJL1|RL2_SALDC 50S ribosomal protein L2 OS=Salmonella dublin (strain CT_02021853) GN=rplB PE=3 SV=1 76 268 4.0E-23
sp|Q57J35|RL2_SALCH 50S ribosomal protein L2 OS=Salmonella choleraesuis (strain SC-B67) GN=rplB PE=3 SV=1 76 268 4.0E-23
sp|A9MN51|RL2_SALAR 50S ribosomal protein L2 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rplB PE=3 SV=1 76 268 4.0E-23
sp|B5F8E9|RL2_SALA4 50S ribosomal protein L2 OS=Salmonella agona (strain SL483) GN=rplB PE=3 SV=1 76 268 4.0E-23
sp|Q89A71|RL2_BUCBP 50S ribosomal protein L2 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rplB PE=3 SV=1 76 268 5.0E-23
sp|A9W4Q4|RL2_METEP 50S ribosomal protein L2 OS=Methylobacterium extorquens (strain PA1) GN=rplB PE=3 SV=1 76 258 6.0E-23
sp|B7L0R4|RL2_METC4 50S ribosomal protein L2 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rplB PE=3 SV=1 76 258 6.0E-23
sp|Q1WS93|RL2_LACS1 50S ribosomal protein L2 OS=Lactobacillus salivarius (strain UCC118) GN=rplB PE=3 SV=1 75 275 7.0E-23
sp|B1JIW4|RL2_YERPY 50S ribosomal protein L2 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rplB PE=3 SV=1 76 268 7.0E-23
sp|P60437|RL2_YERPS 50S ribosomal protein L2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rplB PE=3 SV=1 76 268 7.0E-23
sp|A4TGZ5|RL2_YERPP 50S ribosomal protein L2 OS=Yersinia pestis (strain Pestoides F) GN=rplB PE=3 SV=1 76 268 7.0E-23
sp|Q1CCU7|RL2_YERPN 50S ribosomal protein L2 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rplB PE=3 SV=1 76 268 7.0E-23
sp|A9R8Z9|RL2_YERPG 50S ribosomal protein L2 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rplB PE=3 SV=1 76 268 7.0E-23
sp|P60436|RL2_YERPE 50S ribosomal protein L2 OS=Yersinia pestis GN=rplB PE=3 SV=1 76 268 7.0E-23
sp|B2K5M7|RL2_YERPB 50S ribosomal protein L2 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rplB PE=3 SV=1 76 268 7.0E-23
sp|Q1C2V0|RL2_YERPA 50S ribosomal protein L2 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rplB PE=3 SV=1 76 268 7.0E-23
sp|A7FNN2|RL2_YERP3 50S ribosomal protein L2 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rplB PE=3 SV=1 76 268 7.0E-23
sp|Q6KI52|RL2_MYCMO 50S ribosomal protein L2 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=rplB PE=3 SV=1 75 298 7.0E-23
sp|Q32B34|RL2_SHIDS 50S ribosomal protein L2 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rplB PE=3 SV=1 76 268 7.0E-23
sp|A5ELM4|RL2_BRASB 50S ribosomal protein L2 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rplB PE=3 SV=1 76 258 7.0E-23
sp|O62940|RK2_PINTH 50S ribosomal protein L2, chloroplastic OS=Pinus thunbergii GN=rpl2 PE=3 SV=1 56 282 8.0E-23
sp|B8IS88|RL2_METNO 50S ribosomal protein L2 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rplB PE=3 SV=1 76 258 8.0E-23
sp|Q3YWU2|RL2_SHISS 50S ribosomal protein L2 OS=Shigella sonnei (strain Ss046) GN=rplB PE=3 SV=1 76 268 8.0E-23
sp|P60429|RL2_SHIFL 50S ribosomal protein L2 OS=Shigella flexneri GN=rplB PE=3 SV=2 76 268 8.0E-23
sp|Q0SZY6|RL2_SHIF8 50S ribosomal protein L2 OS=Shigella flexneri serotype 5b (strain 8401) GN=rplB PE=3 SV=1 76 268 8.0E-23
sp|Q31VV9|RL2_SHIBS 50S ribosomal protein L2 OS=Shigella boydii serotype 4 (strain Sb227) GN=rplB PE=3 SV=1 76 268 8.0E-23
sp|B2U2T5|RL2_SHIB3 50S ribosomal protein L2 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rplB PE=3 SV=1 76 268 8.0E-23
sp|B7LRT3|RL2_ESCF3 50S ribosomal protein L2 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rplB PE=3 SV=1 76 268 8.0E-23
sp|Q1R607|RL2_ECOUT 50S ribosomal protein L2 OS=Escherichia coli (strain UTI89 / UPEC) GN=rplB PE=3 SV=1 76 268 8.0E-23
sp|B1LHD1|RL2_ECOSM 50S ribosomal protein L2 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rplB PE=3 SV=1 76 268 8.0E-23
sp|B6I231|RL2_ECOSE 50S ribosomal protein L2 OS=Escherichia coli (strain SE11) GN=rplB PE=3 SV=1 76 268 8.0E-23
sp|B7NDT8|RL2_ECOLU 50S ribosomal protein L2 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rplB PE=3 SV=1 76 268 8.0E-23
sp|P60422|RL2_ECOLI 50S ribosomal protein L2 OS=Escherichia coli (strain K12) GN=rplB PE=1 SV=2 76 268 8.0E-23
sp|B1IPY2|RL2_ECOLC 50S ribosomal protein L2 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rplB PE=3 SV=1 76 268 8.0E-23
sp|P60423|RL2_ECOL6 50S ribosomal protein L2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rplB PE=3 SV=2 76 268 8.0E-23
sp|Q0TCE4|RL2_ECOL5 50S ribosomal protein L2 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rplB PE=3 SV=1 76 268 8.0E-23
sp|A1AGK5|RL2_ECOK1 50S ribosomal protein L2 OS=Escherichia coli O1:K1 / APEC GN=rplB PE=3 SV=1 76 268 8.0E-23
sp|A8A5C2|RL2_ECOHS 50S ribosomal protein L2 OS=Escherichia coli O9:H4 (strain HS) GN=rplB PE=3 SV=1 76 268 8.0E-23
sp|B1X6G8|RL2_ECODH 50S ribosomal protein L2 OS=Escherichia coli (strain K12 / DH10B) GN=rplB PE=3 SV=1 76 268 8.0E-23
sp|C4ZUH2|RL2_ECOBW 50S ribosomal protein L2 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rplB PE=3 SV=1 76 268 8.0E-23
sp|B7M1N1|RL2_ECO8A 50S ribosomal protein L2 OS=Escherichia coli O8 (strain IAI1) GN=rplB PE=3 SV=1 76 268 8.0E-23
sp|B7N1A1|RL2_ECO81 50S ribosomal protein L2 OS=Escherichia coli O81 (strain ED1a) GN=rplB PE=3 SV=1 76 268 8.0E-23
sp|B7NLN6|RL2_ECO7I 50S ribosomal protein L2 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rplB PE=3 SV=1 76 268 8.0E-23
sp|B5YTN8|RL2_ECO5E 50S ribosomal protein L2 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rplB PE=3 SV=1 76 268 8.0E-23
sp|P60424|RL2_ECO57 50S ribosomal protein L2 OS=Escherichia coli O157:H7 GN=rplB PE=3 SV=2 76 268 8.0E-23
sp|B7L4K6|RL2_ECO55 50S ribosomal protein L2 OS=Escherichia coli (strain 55989 / EAEC) GN=rplB PE=3 SV=1 76 268 8.0E-23
sp|B7MCT2|RL2_ECO45 50S ribosomal protein L2 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rplB PE=3 SV=1 76 268 8.0E-23
sp|B7UK41|RL2_ECO27 50S ribosomal protein L2 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rplB PE=3 SV=1 76 268 8.0E-23
sp|A7ZSK6|RL2_ECO24 50S ribosomal protein L2 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rplB PE=3 SV=1 76 268 8.0E-23
sp|O62954|RK2_PICAB 50S ribosomal protein L2, chloroplastic OS=Picea abies GN=rpl2 PE=3 SV=1 56 282 1.0E-22
sp|Q89J87|RL2_BRADU 50S ribosomal protein L2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rplB PE=3 SV=1 76 258 1.0E-22
sp|Q7MYF4|RL2_PHOLL 50S ribosomal protein L2 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rplB PE=3 SV=1 76 268 1.0E-22
sp|A8GKJ4|RL2_SERP5 50S ribosomal protein L2 OS=Serratia proteamaculans (strain 568) GN=rplB PE=3 SV=1 76 268 1.0E-22
sp|Q85WS5|RK2_PINKO 50S ribosomal protein L2, chloroplastic OS=Pinus koraiensis GN=rpl2 PE=3 SV=1 56 282 1.0E-22
sp|A4YSJ5|RL2_BRASO 50S ribosomal protein L2 OS=Bradyrhizobium sp. (strain ORS278) GN=rplB PE=3 SV=1 76 258 1.0E-22
sp|A4WFC5|RL2_ENT38 50S ribosomal protein L2 OS=Enterobacter sp. (strain 638) GN=rplB PE=3 SV=1 76 268 1.0E-22
sp|P49239|RL2_YEREN 50S ribosomal protein L2 OS=Yersinia enterocolitica GN=rplB PE=3 SV=1 76 268 2.0E-22
sp|A1JS34|RL2_YERE8 50S ribosomal protein L2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rplB PE=3 SV=1 76 268 2.0E-22
sp|B1ZLK7|RL2_METPB 50S ribosomal protein L2 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rplB PE=3 SV=1 76 258 2.0E-22
sp|Q057A7|RL2_BUCCC 50S ribosomal protein L2 OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=rplB PE=3 SV=1 76 268 2.0E-22
sp|B0V6X1|RL2_ACIBY 50S ribosomal protein L2 OS=Acinetobacter baumannii (strain AYE) GN=rplB PE=3 SV=1 76 282 2.0E-22
sp|A3M980|RL2_ACIBT 50S ribosomal protein L2 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rplB PE=3 SV=2 76 282 2.0E-22
sp|B0VQS1|RL2_ACIBS 50S ribosomal protein L2 OS=Acinetobacter baumannii (strain SDF) GN=rplB PE=3 SV=1 76 282 2.0E-22
sp|B7IA36|RL2_ACIB5 50S ribosomal protein L2 OS=Acinetobacter baumannii (strain AB0057) GN=rplB PE=3 SV=1 76 282 2.0E-22
sp|B7GW05|RL2_ACIB3 50S ribosomal protein L2 OS=Acinetobacter baumannii (strain AB307-0294) GN=rplB PE=3 SV=1 76 282 2.0E-22
sp|Q9XD33|RL2_LEPIN 50S ribosomal protein L2 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=rplB PE=3 SV=2 75 258 2.0E-22
sp|Q72NG4|RL2_LEPIC 50S ribosomal protein L2 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=rplB PE=3 SV=1 75 258 2.0E-22
sp|A8AZM2|RL2_STRGC 50S ribosomal protein L2 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rplB PE=3 SV=1 76 261 2.0E-22
sp|A3CK66|RL2_STRSV 50S ribosomal protein L2 OS=Streptococcus sanguinis (strain SK36) GN=rplB PE=3 SV=1 76 261 3.0E-22
sp|B8D846|RL2_BUCAT 50S ribosomal protein L2 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=rplB PE=3 SV=1 76 268 3.0E-22
sp|P57588|RL2_BUCAI 50S ribosomal protein L2 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rplB PE=3 SV=1 76 268 3.0E-22
sp|B8D9U4|RL2_BUCA5 50S ribosomal protein L2 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=rplB PE=3 SV=1 76 268 3.0E-22
sp|B0UHW6|RL2_METS4 50S ribosomal protein L2 OS=Methylobacterium sp. (strain 4-46) GN=rplB PE=3 SV=1 76 258 3.0E-22
sp|Q1LTD5|RL2_BAUCH 50S ribosomal protein L2 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rplB PE=3 SV=1 75 268 3.0E-22
sp|Q7VQE5|RL2_BLOFL 50S ribosomal protein L2 OS=Blochmannia floridanus GN=rplB PE=3 SV=1 75 268 4.0E-22
sp|Q5GSU7|RL2_WOLTR 50S ribosomal protein L2 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=rplB PE=3 SV=1 75 258 4.0E-22
sp|Q2N9B4|RL2_ERYLH 50S ribosomal protein L2 OS=Erythrobacter litoralis (strain HTCC2594) GN=rplB PE=3 SV=1 75 258 4.0E-22
sp|B1LWS9|RL2_METRJ 50S ribosomal protein L2 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rplB PE=3 SV=1 76 258 4.0E-22
sp|B2VK61|RL2_ERWT9 50S ribosomal protein L2 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rplB PE=3 SV=1 76 268 5.0E-22
sp|B3PMP4|RL2_MYCA5 50S ribosomal protein L2 OS=Mycoplasma arthritidis (strain 158L3-1) GN=rplB PE=3 SV=1 76 290 5.0E-22
sp|Q04G82|RL2_OENOB 50S ribosomal protein L2 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rplB PE=3 SV=1 75 261 5.0E-22
sp|B9DSV3|RL2_STRU0 50S ribosomal protein L2 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rplB PE=3 SV=1 76 261 7.0E-22
sp|Q1J911|RL2_STRPF 50S ribosomal protein L2 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rplB PE=3 SV=1 76 261 7.0E-22
sp|Q7VKD5|RL2_HAEDU 50S ribosomal protein L2 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rplB PE=3 SV=1 76 268 8.0E-22
sp|C0R306|RL2_WOLWR 50S ribosomal protein L2 OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=rplB PE=3 SV=1 75 258 8.0E-22
sp|B4F1I7|RL2_PROMH 50S ribosomal protein L2 OS=Proteus mirabilis (strain HI4320) GN=rplB PE=3 SV=1 76 268 8.0E-22
sp|B5XJ39|RL2_STRPZ 50S ribosomal protein L2 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=rplB PE=3 SV=1 76 261 8.0E-22
sp|P0DE35|RL2_STRPQ 50S ribosomal protein L2 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rplB PE=3 SV=1 76 261 8.0E-22
sp|Q48VU6|RL2_STRPM 50S ribosomal protein L2 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rplB PE=3 SV=1 76 261 8.0E-22
sp|A2RC17|RL2_STRPG 50S ribosomal protein L2 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rplB PE=3 SV=1 76 261 8.0E-22
sp|Q1JJ59|RL2_STRPD 50S ribosomal protein L2 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rplB PE=3 SV=1 76 261 8.0E-22
sp|Q1JP14|RL2_STRPC 50S ribosomal protein L2 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rplB PE=3 SV=1 76 261 8.0E-22
sp|Q1JE55|RL2_STRPB 50S ribosomal protein L2 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rplB PE=3 SV=1 76 261 8.0E-22
sp|P60435|RL2_STRP8 50S ribosomal protein L2 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rplB PE=3 SV=1 76 261 8.0E-22
sp|Q5XED2|RL2_STRP6 50S ribosomal protein L2 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rplB PE=3 SV=1 76 261 8.0E-22
sp|P0DE34|RL2_STRP3 50S ribosomal protein L2 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rplB PE=3 SV=1 76 261 8.0E-22
sp|P60434|RL2_STRP1 50S ribosomal protein L2 OS=Streptococcus pyogenes serotype M1 GN=rplB PE=3 SV=1 76 261 8.0E-22
sp|Q2W2J4|RL2_MAGSA 50S ribosomal protein L2 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rplB PE=3 SV=1 75 258 8.0E-22
sp|Q98N54|RL2_RHILO 50S ribosomal protein L2 OS=Rhizobium loti (strain MAFF303099) GN=rplB PE=3 SV=1 76 258 9.0E-22
sp|P60433|RL2_STAAW 50S ribosomal protein L2 OS=Staphylococcus aureus (strain MW2) GN=rplB PE=3 SV=1 75 275 9.0E-22
sp|Q6G774|RL2_STAAS 50S ribosomal protein L2 OS=Staphylococcus aureus (strain MSSA476) GN=rplB PE=3 SV=1 75 275 9.0E-22
sp|Q6GEI6|RL2_STAAR 50S ribosomal protein L2 OS=Staphylococcus aureus (strain MRSA252) GN=rplB PE=3 SV=1 75 275 9.0E-22
sp|P60432|RL2_STAAN 50S ribosomal protein L2 OS=Staphylococcus aureus (strain N315) GN=rplB PE=1 SV=1 75 275 9.0E-22
sp|P60431|RL2_STAAM 50S ribosomal protein L2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rplB PE=3 SV=1 75 275 9.0E-22
sp|A6QJ89|RL2_STAAE 50S ribosomal protein L2 OS=Staphylococcus aureus (strain Newman) GN=rplB PE=3 SV=1 75 275 9.0E-22
sp|Q5HDW1|RL2_STAAC 50S ribosomal protein L2 OS=Staphylococcus aureus (strain COL) GN=rplB PE=3 SV=1 75 275 9.0E-22
sp|Q2YYP9|RL2_STAAB 50S ribosomal protein L2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rplB PE=3 SV=1 75 275 9.0E-22
sp|A5IV31|RL2_STAA9 50S ribosomal protein L2 OS=Staphylococcus aureus (strain JH9) GN=rplB PE=3 SV=1 75 275 9.0E-22
sp|P60430|RL2_STAA8 50S ribosomal protein L2 OS=Staphylococcus aureus (strain NCTC 8325) GN=rplB PE=1 SV=1 75 275 9.0E-22
sp|Q2FEP2|RL2_STAA3 50S ribosomal protein L2 OS=Staphylococcus aureus (strain USA300) GN=rplB PE=3 SV=1 75 275 9.0E-22
sp|A6U3X2|RL2_STAA2 50S ribosomal protein L2 OS=Staphylococcus aureus (strain JH1) GN=rplB PE=3 SV=1 75 275 9.0E-22
sp|A7X5G0|RL2_STAA1 50S ribosomal protein L2 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rplB PE=3 SV=1 75 275 9.0E-22
sp|Q6F7R5|RL2_ACIAD 50S ribosomal protein L2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rplB PE=3 SV=1 76 282 1.0E-21
sp|A4GYV2|RK2_POPTR 50S ribosomal protein L2, chloroplastic OS=Populus trichocarpa GN=rpl2-A PE=3 SV=1 57 261 1.0E-21
sp|A8LM57|RL2_DINSH 50S ribosomal protein L2 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rplB PE=3 SV=1 76 258 1.0E-21
sp|Q73H89|RL2_WOLPM 50S ribosomal protein L2 OS=Wolbachia pipientis wMel GN=rplB PE=3 SV=1 75 258 1.0E-21
sp|A4WVK5|RL2_RHOS5 50S ribosomal protein L2 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rplB PE=3 SV=1 76 258 1.0E-21
sp|Q14FB6|RK2B_POPAL 50S ribosomal protein L2-B, chloroplastic OS=Populus alba GN=rpl2-B PE=3 SV=1 32 261 1.0E-21
sp|P55835|RL2_AGGAC 50S ribosomal protein L2 OS=Aggregatibacter actinomycetemcomitans GN=rplB PE=3 SV=2 76 268 1.0E-21
sp|Q5NQ61|RL2_ZYMMO 50S ribosomal protein L2 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rplB PE=3 SV=1 75 258 1.0E-21
sp|Q055E1|RL2_LEPBL 50S ribosomal protein L2 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=rplB1 PE=3 SV=1 75 258 2.0E-21
sp|Q04PU1|RL2_LEPBJ 50S ribosomal protein L2 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=rplB PE=3 SV=1 75 258 2.0E-21
sp|Q8ETX9|RL2_OCEIH 50S ribosomal protein L2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rplB PE=3 SV=1 75 275 2.0E-21
sp|B9KL94|RL2_RHOSK 50S ribosomal protein L2 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rplB PE=3 SV=1 76 258 2.0E-21
sp|Q3J5R9|RL2_RHOS4 50S ribosomal protein L2 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rplB PE=3 SV=1 76 258 2.0E-21
sp|A3PGL4|RL2_RHOS1 50S ribosomal protein L2 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rplB PE=3 SV=1 76 258 2.0E-21
sp|A6YGC4|RK2_LEPTE 50S ribosomal protein L2, chloroplastic OS=Leptosira terrestris GN=rpl2 PE=3 SV=1 76 282 2.0E-21
sp|Q493K5|RL2_BLOPB 50S ribosomal protein L2 OS=Blochmannia pennsylvanicus (strain BPEN) GN=rplB PE=3 SV=1 75 268 2.0E-21
sp|C0MCB3|RL2_STRS7 50S ribosomal protein L2 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rplB PE=3 SV=1 76 261 2.0E-21
sp|B4U503|RL2_STREM 50S ribosomal protein L2 OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=rplB PE=3 SV=1 76 261 2.0E-21
sp|B3CN29|RL2_WOLPP 50S ribosomal protein L2 OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=rplB PE=3 SV=1 75 258 2.0E-21
sp|A6H5M3|RK2_CYCTA 50S ribosomal protein L2, chloroplastic OS=Cycas taitungensis GN=rpl2 PE=3 SV=1 57 282 2.0E-21
sp|C1CP91|RL2_STRZT 50S ribosomal protein L2 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rplB PE=3 SV=1 76 261 3.0E-21
sp|C1CIA0|RL2_STRZP 50S ribosomal protein L2 OS=Streptococcus pneumoniae (strain P1031) GN=rplB PE=3 SV=1 76 261 3.0E-21
sp|C1CC09|RL2_STRZJ 50S ribosomal protein L2 OS=Streptococcus pneumoniae (strain JJA) GN=rplB PE=3 SV=1 76 261 3.0E-21
sp|Q8CWV5|RL2_STRR6 50S ribosomal protein L2 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rplB PE=3 SV=1 76 261 3.0E-21
sp|B2IS43|RL2_STRPS 50S ribosomal protein L2 OS=Streptococcus pneumoniae (strain CGSP14) GN=rplB PE=3 SV=1 76 261 3.0E-21
sp|Q97SV2|RL2_STRPN 50S ribosomal protein L2 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rplB PE=3 SV=1 76 261 3.0E-21
sp|B8ZKG0|RL2_STRPJ 50S ribosomal protein L2 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rplB PE=3 SV=1 76 261 3.0E-21
sp|B1I8K1|RL2_STRPI 50S ribosomal protein L2 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rplB PE=3 SV=1 76 261 3.0E-21
sp|C1CAL5|RL2_STRP7 50S ribosomal protein L2 OS=Streptococcus pneumoniae (strain 70585) GN=rplB PE=3 SV=1 76 261 3.0E-21
sp|B5E6F8|RL2_STRP4 50S ribosomal protein L2 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rplB PE=3 SV=1 76 261 3.0E-21
sp|Q04MN3|RL2_STRP2 50S ribosomal protein L2 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rplB PE=3 SV=1 76 261 3.0E-21
sp|Q1ACF6|RK2_CHAVU 50S ribosomal protein L2, chloroplastic OS=Chara vulgaris GN=rpl2 PE=3 SV=1 25 261 3.0E-21
sp|B8F758|RL2_HAEPS 50S ribosomal protein L2 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rplB PE=3 SV=1 76 268 3.0E-21
sp|Q03PW0|RL2_LACBA 50S ribosomal protein L2 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rplB PE=3 SV=1 75 261 3.0E-21
sp|Q4A5C4|RL2_MYCS5 50S ribosomal protein L2 OS=Mycoplasma synoviae (strain 53) GN=rplB PE=3 SV=1 76 275 3.0E-21
sp|Q211F1|RL2_RHOPB 50S ribosomal protein L2 OS=Rhodopseudomonas palustris (strain BisB18) GN=rplB PE=3 SV=1 76 258 3.0E-21
sp|Q4L8B1|RL2_STAHJ 50S ribosomal protein L2 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rplB PE=3 SV=1 75 275 3.0E-21
sp|A5WCJ3|RL2_PSYWF 50S ribosomal protein L2 OS=Psychrobacter sp. (strain PRwf-1) GN=rplB PE=3 SV=1 76 271 3.0E-21
sp|Q03IF4|RL2_STRTD 50S ribosomal protein L2 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rplB PE=3 SV=1 76 261 4.0E-21
sp|Q5M2B6|RL2_STRT2 50S ribosomal protein L2 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rplB PE=3 SV=1 76 261 4.0E-21
sp|Q5LXR4|RL2_STRT1 50S ribosomal protein L2 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rplB PE=3 SV=1 76 261 4.0E-21
sp|B2G8X5|RL2_LACRJ 50S ribosomal protein L2 OS=Lactobacillus reuteri (strain JCM 1112) GN=rplB PE=3 SV=1 75 275 4.0E-21
sp|A5VLK2|RL2_LACRD 50S ribosomal protein L2 OS=Lactobacillus reuteri (strain DSM 20016) GN=rplB PE=3 SV=1 75 275 4.0E-21
sp|Q8GM57|RL2_MYCHP 50S ribosomal protein L2 OS=Mycoplasma hominis (strain ATCC 23114 / NBRC 14850 / NCTC 10111 / PG21) GN=rplB PE=3 SV=1 76 275 4.0E-21
sp|A7M9A4|RK2_CUSRE 50S ribosomal protein L2, plastid OS=Cuscuta reflexa GN=rpl2 PE=3 SV=1 25 261 4.0E-21
sp|C0M6X2|RL2_STRE4 50S ribosomal protein L2 OS=Streptococcus equi subsp. equi (strain 4047) GN=rplB PE=3 SV=1 76 261 4.0E-21
sp|B1MW11|RL2_LEUCK 50S ribosomal protein L2 OS=Leuconostoc citreum (strain KM20) GN=rplB PE=3 SV=1 76 275 5.0E-21
sp|A4VSF7|RL2_STRSY 50S ribosomal protein L2 OS=Streptococcus suis (strain 05ZYH33) GN=rplB PE=3 SV=1 76 261 5.0E-21
sp|A4VYP6|RL2_STRS2 50S ribosomal protein L2 OS=Streptococcus suis (strain 98HAH33) GN=rplB PE=3 SV=1 76 261 5.0E-21
sp|Q1GPA2|RL2_SPHAL 50S ribosomal protein L2 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rplB PE=3 SV=1 75 258 6.0E-21
sp|Q8CRG3|RL2_STAES 50S ribosomal protein L2 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rplB PE=3 SV=1 75 275 6.0E-21
sp|Q5HM02|RL2_STAEQ 50S ribosomal protein L2 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rplB PE=3 SV=1 75 275 6.0E-21
sp|B8ELG0|RL2_METSB 50S ribosomal protein L2 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rplB PE=3 SV=1 76 258 7.0E-21
sp|Q03EB9|RL2_PEDPA 50S ribosomal protein L2 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rplB PE=3 SV=1 75 275 7.0E-21
sp|Q65QV8|RL2_MANSM 50S ribosomal protein L2 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rplB PE=3 SV=1 76 268 7.0E-21
sp|Q9CL35|RL2_PASMU 50S ribosomal protein L2 OS=Pasteurella multocida (strain Pm70) GN=rplB PE=3 SV=1 76 268 8.0E-21
sp|B0BST4|RL2_ACTPJ 50S ribosomal protein L2 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rplB PE=3 SV=1 76 268 8.0E-21
sp|B3GZ14|RL2_ACTP7 50S ribosomal protein L2 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rplB PE=3 SV=1 76 268 8.0E-21
sp|A3N361|RL2_ACTP2 50S ribosomal protein L2 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rplB PE=3 SV=1 76 268 8.0E-21
sp|B2V7L0|RL2_SULSY 50S ribosomal protein L2 OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=rplB PE=3 SV=1 76 268 8.0E-21
sp|Q839G1|RL2_ENTFA 50S ribosomal protein L2 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rplB PE=3 SV=1 75 290 9.0E-21
sp|B2A4E2|RL2_NATTJ 50S ribosomal protein L2 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rplB PE=3 SV=2 75 289 9.0E-21
sp|A0ALW5|RL2_LISW6 50S ribosomal protein L2 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rplB PE=3 SV=1 75 275 1.0E-20
sp|P60426|RL2_LISMO 50S ribosomal protein L2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rplB PE=3 SV=1 75 275 1.0E-20
sp|Q71WE9|RL2_LISMF 50S ribosomal protein L2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rplB PE=3 SV=1 75 275 1.0E-20
sp|C1KZH7|RL2_LISMC 50S ribosomal protein L2 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rplB PE=3 SV=1 75 275 1.0E-20
sp|P60425|RL2_LISIN 50S ribosomal protein L2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rplB PE=3 SV=1 75 275 1.0E-20
sp|A1B030|RL2_PARDP 50S ribosomal protein L2 OS=Paracoccus denitrificans (strain Pd 1222) GN=rplB PE=3 SV=1 76 258 1.0E-20
sp|Q1RHM4|RL2_RICBR 50S ribosomal protein L2 OS=Rickettsia bellii (strain RML369-C) GN=rplB PE=3 SV=1 76 258 1.0E-20
sp|A8GVB7|RL2_RICB8 50S ribosomal protein L2 OS=Rickettsia bellii (strain OSU 85-389) GN=rplB PE=3 SV=1 76 258 1.0E-20
sp|A8W3G2|RK2_CUSEX 50S ribosomal protein L2, plastid OS=Cuscuta exaltata GN=rpl2 PE=3 SV=1 25 261 1.0E-20
sp|Q4FUF3|RL2_PSYA2 50S ribosomal protein L2 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rplB PE=3 SV=1 76 282 1.0E-20
sp|Q2G8X7|RL2_NOVAD 50S ribosomal protein L2 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rplB PE=3 SV=1 75 258 2.0E-20
sp|Q1QDI3|RL2_PSYCK 50S ribosomal protein L2 OS=Psychrobacter cryohalolentis (strain K5) GN=rplB PE=3 SV=1 76 282 2.0E-20
sp|Q8E2C8|RL2_STRA5 50S ribosomal protein L2 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rplB PE=3 SV=1 76 261 2.0E-20
sp|Q8E7T5|RL2_STRA3 50S ribosomal protein L2 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rplB PE=3 SV=1 76 261 2.0E-20
sp|Q3K3W6|RL2_STRA1 50S ribosomal protein L2 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rplB PE=3 SV=1 76 261 2.0E-20
sp|Q28UV7|RL2_JANSC 50S ribosomal protein L2 OS=Jannaschia sp. (strain CCS1) GN=rplB PE=3 SV=1 63 258 2.0E-20
sp|B2S2D9|RL2_TREPS 50S ribosomal protein L2 OS=Treponema pallidum subsp. pallidum (strain SS14) GN=rplB PE=3 SV=1 75 257 2.0E-20
sp|O83222|RL2_TREPA 50S ribosomal protein L2 OS=Treponema pallidum (strain Nichols) GN=rplB PE=3 SV=1 75 257 2.0E-20
sp|A5V5Z9|RL2_SPHWW 50S ribosomal protein L2 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rplB PE=3 SV=1 75 258 2.0E-20
sp|Q9TJQ5|RK2_PROWI 50S ribosomal protein L2, plastid OS=Prototheca wickerhamii GN=rpl2 PE=3 SV=1 76 275 2.0E-20
sp|A6VLJ1|RL2_ACTSZ 50S ribosomal protein L2 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rplB PE=3 SV=1 76 268 2.0E-20
sp|B6IRQ9|RL2_RHOCS 50S ribosomal protein L2 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rplB PE=3 SV=1 75 258 2.0E-20
sp|A7HWR4|RL2_PARL1 50S ribosomal protein L2 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rplB PE=3 SV=1 76 258 2.0E-20
sp|A8GPE7|RL2_RICAH 50S ribosomal protein L2 OS=Rickettsia akari (strain Hartford) GN=rplB PE=3 SV=1 76 258 2.0E-20
sp|Q0I160|RL2_HAES1 50S ribosomal protein L2 OS=Haemophilus somnus (strain 129Pt) GN=rplB PE=3 SV=1 76 268 2.0E-20
sp|Q88XY3|RL2_LACPL 50S ribosomal protein L2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rplB PE=3 SV=1 75 275 2.0E-20
sp|B0UX16|RL2_HISS2 50S ribosomal protein L2 OS=Histophilus somni (strain 2336) GN=rplB PE=3 SV=1 76 268 3.0E-20
sp|Q06GT2|RK2_DRIGR 50S ribosomal protein L2, chloroplastic OS=Drimys granadensis GN=rpl2-A PE=3 SV=1 56 261 3.0E-20
sp|Q38UR5|RL2_LACSS 50S ribosomal protein L2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rplB PE=3 SV=1 76 293 3.0E-20
sp|A7Y3J3|RK2_IPOPU 50S ribosomal protein L2, chloroplastic OS=Ipomoea purpurea GN=rpl2 PE=3 SV=1 38 282 3.0E-20
sp|A8IAR8|RL2_AZOC5 50S ribosomal protein L2 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rplB PE=3 SV=1 76 258 3.0E-20
sp|Q9ZCQ8|RL2_RICPR 50S ribosomal protein L2 OS=Rickettsia prowazekii (strain Madrid E) GN=rplB PE=3 SV=1 76 258 3.0E-20
sp|A0ZZ76|RK2_GOSBA 50S ribosomal protein L2, chloroplastic OS=Gossypium barbadense GN=rpl2-A PE=3 SV=1 37 261 3.0E-20
sp|B4R8M0|RL2_PHEZH 50S ribosomal protein L2 OS=Phenylobacterium zucineum (strain HLK1) GN=rplB PE=3 SV=1 76 258 3.0E-20
sp|Q14F95|RK2A_POPAL 50S ribosomal protein L2-A, chloroplastic OS=Populus alba GN=rpl2-A PE=3 SV=1 37 261 3.0E-20
sp|Q03ZP2|RL2_LEUMM 50S ribosomal protein L2 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rplB PE=3 SV=1 76 275 3.0E-20
sp|Q49ZG5|RL2_STAS1 50S ribosomal protein L2 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rplB PE=3 SV=1 75 275 4.0E-20
sp|B3EUM0|RL2_AMOA5 50S ribosomal protein L2 OS=Amoebophilus asiaticus (strain 5a2) GN=rplB PE=3 SV=1 75 257 4.0E-20
sp|A8YXK8|RL2_LACH4 50S ribosomal protein L2 OS=Lactobacillus helveticus (strain DPC 4571) GN=rplB PE=3 SV=1 75 261 4.0E-20
sp|Q4VZK5|RK2_CUCSA 50S ribosomal protein L2, chloroplastic OS=Cucumis sativus GN=rpl2-A PE=3 SV=1 37 261 4.0E-20
sp|Q0BUP7|RL2_GRABC 50S ribosomal protein L2 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rplB PE=3 SV=2 76 258 4.0E-20
sp|Q74L86|RL2_LACJO 50S ribosomal protein L2 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rplB PE=3 SV=1 75 261 4.0E-20
sp|P44343|RL2_HAEIN 50S ribosomal protein L2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rplB PE=3 SV=2 76 268 5.0E-20
sp|A5UHT3|RL2_HAEIG 50S ribosomal protein L2 OS=Haemophilus influenzae (strain PittGG) GN=rplB PE=3 SV=1 76 268 5.0E-20
sp|A5UDU4|RL2_HAEIE 50S ribosomal protein L2 OS=Haemophilus influenzae (strain PittEE) GN=rplB PE=3 SV=1 76 268 5.0E-20
sp|Q4QMB9|RL2_HAEI8 50S ribosomal protein L2 OS=Haemophilus influenzae (strain 86-028NP) GN=rplB PE=3 SV=1 76 268 5.0E-20
sp|B0RZU3|RL2_FINM2 50S ribosomal protein L2 OS=Finegoldia magna (strain ATCC 29328) GN=rplB PE=3 SV=1 72 261 5.0E-20
sp|B9IZJ7|RL2_BACCQ 50S ribosomal protein L2 OS=Bacillus cereus (strain Q1) GN=rplB PE=3 SV=1 75 275 5.0E-20
sp|A4GGF8|RK2_PHAVU 50S ribosomal protein L2, chloroplastic OS=Phaseolus vulgaris GN=rpl2-A PE=3 SV=1 56 261 5.0E-20
sp|Q8LVH2|RK2_PHAAN 50S ribosomal protein L2, chloroplastic OS=Phaseolus angularis GN=rpl2 PE=3 SV=1 56 261 6.0E-20
sp|Q16AE8|RL2_ROSDO 50S ribosomal protein L2 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rplB PE=3 SV=1 76 258 6.0E-20
sp|B1NWJ1|RK2_MANES 50S ribosomal protein L2, chloroplastic OS=Manihot esculenta GN=rpl2-A PE=3 SV=1 56 261 6.0E-20
sp|Q5LW59|RL2_RUEPO 50S ribosomal protein L2 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rplB PE=3 SV=1 76 258 6.0E-20
sp|Q332R5|RK2_LACSA 50S ribosomal protein L2, chloroplastic OS=Lactuca sativa GN=rpl2-A PE=3 SV=1 56 261 7.0E-20
sp|A6MM78|RK2_BUXMI 50S ribosomal protein L2, chloroplastic OS=Buxus microphylla GN=rpl2-A PE=3 SV=1 37 261 7.0E-20
sp|Q6HPQ5|RL2_BACHK 50S ribosomal protein L2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rplB PE=3 SV=1 75 275 7.0E-20
sp|Q63H87|RL2_BACCZ 50S ribosomal protein L2 OS=Bacillus cereus (strain ZK / E33L) GN=rplB PE=3 SV=1 75 275 7.0E-20
sp|B7HQU7|RL2_BACC7 50S ribosomal protein L2 OS=Bacillus cereus (strain AH187) GN=rplB PE=3 SV=1 75 275 7.0E-20
sp|C1ET42|RL2_BACC3 50S ribosomal protein L2 OS=Bacillus cereus (strain 03BB102) GN=rplB PE=3 SV=1 75 275 7.0E-20
sp|Q73F93|RL2_BACC1 50S ribosomal protein L2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rplB PE=3 SV=1 75 275 7.0E-20
sp|B7JKC2|RL2_BACC0 50S ribosomal protein L2 OS=Bacillus cereus (strain AH820) GN=rplB PE=3 SV=1 75 275 7.0E-20
sp|Q81VS7|RL2_BACAN 50S ribosomal protein L2 OS=Bacillus anthracis GN=rplB PE=3 SV=1 75 275 7.0E-20
sp|A0R8I3|RL2_BACAH 50S ribosomal protein L2 OS=Bacillus thuringiensis (strain Al Hakam) GN=rplB PE=3 SV=1 75 275 7.0E-20
sp|C3LJ85|RL2_BACAC 50S ribosomal protein L2 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rplB PE=3 SV=1 75 275 7.0E-20
sp|C3P9Q8|RL2_BACAA 50S ribosomal protein L2 OS=Bacillus anthracis (strain A0248) GN=rplB PE=3 SV=1 75 275 7.0E-20
sp|Q2PMM3|RK2B_SOYBN 50S ribosomal protein L2-B, chloroplastic OS=Glycine max GN=rpl2-B PE=3 SV=1 56 261 7.0E-20
sp|Q6EVY5|RK2_NYMAL 50S ribosomal protein L2, chloroplastic OS=Nymphaea alba GN=rpl2-A PE=3 SV=1 56 261 7.0E-20
sp|Q09MB2|RK2_CITSI 50S ribosomal protein L2, chloroplastic OS=Citrus sinensis GN=rpl2-A PE=3 SV=1 37 261 7.0E-20
sp|A8EZL3|RL2_RICCK 50S ribosomal protein L2 OS=Rickettsia canadensis (strain McKiel) GN=rplB PE=3 SV=1 76 258 7.0E-20
sp|Q68W81|RL2_RICTY 50S ribosomal protein L2 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rplB PE=3 SV=1 76 258 7.0E-20
sp|Q2RFQ0|RL2_MOOTA 50S ribosomal protein L2 OS=Moorella thermoacetica (strain ATCC 39073) GN=rplB PE=3 SV=1 76 261 8.0E-20
sp|B9MKH8|RL2_CALBD 50S ribosomal protein L2 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rplB PE=3 SV=1 75 261 8.0E-20
sp|Q4UMS6|RL2_RICFE 50S ribosomal protein L2 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rplB PE=3 SV=1 76 258 8.0E-20
sp|A1XFZ7|RK2_NUPAD 50S ribosomal protein L2, chloroplastic OS=Nuphar advena GN=rpl2-A PE=3 SV=1 37 261 8.0E-20
sp|Q2RQW3|RL2_RHORT 50S ribosomal protein L2 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rplB PE=3 SV=1 75 258 8.0E-20
sp|Q81J39|RL2_BACCR 50S ribosomal protein L2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rplB PE=3 SV=1 75 275 8.0E-20
sp|B7HJ51|RL2_BACC4 50S ribosomal protein L2 OS=Bacillus cereus (strain B4264) GN=rplB PE=3 SV=1 75 275 8.0E-20
sp|B7IT22|RL2_BACC2 50S ribosomal protein L2 OS=Bacillus cereus (strain G9842) GN=rplB PE=3 SV=1 75 275 8.0E-20
sp|A4QJP0|RK2_AETGR 50S ribosomal protein L2, chloroplastic OS=Aethionema grandiflorum GN=rpl2-A PE=3 SV=1 37 261 9.0E-20
sp|A4QJF6|RK2_AETCO 50S ribosomal protein L2, chloroplastic OS=Aethionema cordifolium GN=rpl2-A PE=3 SV=1 37 261 9.0E-20
sp|B1VKD7|RK2_CRYJA 50S ribosomal protein L2, chloroplastic OS=Cryptomeria japonica GN=rpl2 PE=3 SV=1 76 282 9.0E-20
sp|A6MMI6|RK2B_CHLSC 50S ribosomal protein L2-B, chloroplastic OS=Chloranthus spicatus GN=rpl2-B PE=3 SV=1 56 261 9.0E-20
sp|A9H3Q5|RL2_GLUDA 50S ribosomal protein L2 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rplB PE=3 SV=1 76 258 9.0E-20
sp|B5RM39|RL2_BORDL 50S ribosomal protein L2 OS=Borrelia duttonii (strain Ly) GN=rplB PE=3 SV=1 79 258 1.0E-19
sp|Q6MSM8|RL2_MYCMS 50S ribosomal protein L2 OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=rplB PE=3 SV=1 75 290 1.0E-19
sp|Q1KXP4|RK2_HELAN 50S ribosomal protein L2, chloroplastic OS=Helianthus annuus GN=rpl2-A PE=3 SV=1 56 261 1.0E-19
sp|B1A976|RK2_CARPA 50S ribosomal protein L2, chloroplastic OS=Carica papaya GN=rpl2-A PE=3 SV=1 56 261 1.0E-19
sp|Q3BAJ4|RK2_PHAAO 50S ribosomal protein L2, chloroplastic OS=Phalaenopsis aphrodite subsp. formosana GN=rpl2-A PE=2 SV=1 56 261 1.0E-19
sp|B5RPI5|RL2_BORRA 50S ribosomal protein L2 OS=Borrelia recurrentis (strain A1) GN=rplB PE=3 SV=1 79 258 1.0E-19
sp|P18663|RK2A_SOYBN 50S ribosomal protein L2-A, chloroplastic OS=Glycine max GN=rpl2-A PE=3 SV=2 56 261 1.0E-19
sp|Q250M9|RL2_DESHY 50S ribosomal protein L2 OS=Desulfitobacterium hafniense (strain Y51) GN=rplB PE=3 SV=1 75 261 1.0E-19
sp|B8G1W9|RL2_DESHD 50S ribosomal protein L2 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rplB PE=3 SV=1 75 261 1.0E-19
sp|P0C497|RK2_ORYSJ 50S ribosomal protein L2, chloroplastic OS=Oryza sativa subsp. japonica GN=rpl2-A PE=3 SV=1 57 261 1.0E-19
sp|P0C496|RK2_ORYSI 50S ribosomal protein L2, chloroplastic OS=Oryza sativa subsp. indica GN=rpl2-A PE=3 SV=1 57 261 1.0E-19
sp|P0C495|RK2_ORYSA 50S ribosomal protein L2, chloroplastic OS=Oryza sativa GN=rpl2-A PE=3 SV=1 57 261 1.0E-19
sp|Q6EN83|RK2_ORYNI 50S ribosomal protein L2, chloroplastic OS=Oryza nivara GN=rpl2-A PE=3 SV=1 57 261 1.0E-19
sp|Q0ZIX7|RK2_VITVI 50S ribosomal protein L2, chloroplastic OS=Vitis vinifera GN=rpl2-A PE=3 SV=1 37 261 1.0E-19
sp|Q6F1Z1|RL2_MESFL 50S ribosomal protein L2 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rplB PE=3 SV=1 75 290 1.0E-19
sp|B5ZYT8|RL2_RHILW 50S ribosomal protein L2 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rplB PE=3 SV=1 76 258 1.0E-19
sp|Q1MID8|RL2_RHIL3 50S ribosomal protein L2 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rplB PE=3 SV=1 76 258 1.0E-19
sp|C0QQM6|RL2_PERMH 50S ribosomal protein L2 OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=rplB PE=3 SV=1 76 268 1.0E-19
sp|Q92GW9|RL2_RICCN 50S ribosomal protein L2 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rplB PE=3 SV=1 76 258 1.0E-19
sp|C3PPA4|RL2_RICAE 50S ribosomal protein L2 OS=Rickettsia africae (strain ESF-5) GN=rplB PE=3 SV=1 76 258 1.0E-19
sp|A7ZG09|RL2_CAMC1 50S ribosomal protein L2 OS=Campylobacter concisus (strain 13826) GN=rplB PE=3 SV=1 76 261 1.0E-19
sp|C4K7B5|RL2_HAMD5 50S ribosomal protein L2 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rplB PE=3 SV=1 76 268 2.0E-19
sp|Q5FM87|RL2_LACAC 50S ribosomal protein L2 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rplB PE=3 SV=1 75 261 2.0E-19
sp|Q9B1H9|RK2_LOTJA 50S ribosomal protein L2, chloroplastic OS=Lotus japonicus GN=rpl2-A PE=3 SV=1 56 290 2.0E-19
sp|A8Y9C8|RK2_LOLPR 50S ribosomal protein L2, chloroplastic OS=Lolium perenne GN=rpl2-A PE=3 SV=1 57 261 2.0E-19
sp|P41096|RK2_HORVU 50S ribosomal protein L2, chloroplastic OS=Hordeum vulgare GN=rpl2-A PE=2 SV=1 57 261 2.0E-19
sp|A1EA50|RK2_AGRST 50S ribosomal protein L2, chloroplastic OS=Agrostis stolonifera GN=rpl2-A PE=3 SV=1 57 261 2.0E-19
sp|A4QKX2|RK2_CRUWA 50S ribosomal protein L2, chloroplastic OS=Crucihimalaya wallichii GN=rpl2-A PE=3 SV=1 56 261 2.0E-19
sp|Q2L944|RK2_GOSHI 50S ribosomal protein L2, chloroplastic OS=Gossypium hirsutum GN=rpl2-A PE=3 SV=1 37 261 2.0E-19
sp|Q49KT4|RK2_EUCGG 50S ribosomal protein L2, chloroplastic OS=Eucalyptus globulus subsp. globulus GN=rpl2-A PE=3 SV=1 31 261 2.0E-19
sp|A4QLX4|RK2_NASOF 50S ribosomal protein L2, chloroplastic OS=Nasturtium officinale GN=rpl2-A PE=3 SV=1 56 261 2.0E-19
sp|C4K2H6|RL2_RICPU 50S ribosomal protein L2 OS=Rickettsia peacockii (strain Rustic) GN=rplB PE=3 SV=1 76 258 2.0E-19
sp|A8GT66|RL2_RICRS 50S ribosomal protein L2 OS=Rickettsia rickettsii (strain Sheila Smith) GN=rplB PE=3 SV=1 76 258 2.0E-19
sp|B0BUQ7|RL2_RICRO 50S ribosomal protein L2 OS=Rickettsia rickettsii (strain Iowa) GN=rplB PE=3 SV=1 76 258 2.0E-19
sp|B9DM16|RL2_STACT 50S ribosomal protein L2 OS=Staphylococcus carnosus (strain TM300) GN=rplB PE=3 SV=1 75 275 2.0E-19
sp|Q09FP6|RK2_NANDO 50S ribosomal protein L2, chloroplastic OS=Nandina domestica GN=rpl2-A PE=3 SV=1 38 261 2.0E-19
sp|Q11QB5|RL2_CYTH3 50S ribosomal protein L2 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=rplB PE=3 SV=1 75 257 2.0E-19
sp|P10133|RL2_MYCCT 50S ribosomal protein L2 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=rplB PE=3 SV=2 75 290 2.0E-19
sp|A9L9D7|RK2_LEMMI 50S ribosomal protein L2, chloroplastic OS=Lemna minor GN=rpl2 PE=2 SV=1 37 261 2.0E-19
sp|P60406|RK2_AMBTC 50S ribosomal protein L2, chloroplastic OS=Amborella trichopoda GN=rpl2-A PE=2 SV=1 56 261 2.0E-19
sp|Q3V4X1|RK2_ACOCL 50S ribosomal protein L2, chloroplastic OS=Acorus calamus GN=rpl2-A PE=3 SV=1 56 261 2.0E-19
sp|A9LYE2|RK2_ACOAM 50S ribosomal protein L2, chloroplastic OS=Acorus americanus GN=rpl2-A PE=3 SV=1 56 261 2.0E-19
sp|Q8K953|RL2_BUCAP 50S ribosomal protein L2 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rplB PE=3 SV=1 76 268 2.0E-19
sp|Q0G9H8|RK2B_LIRTU 50S ribosomal protein L2-B, chloroplastic OS=Liriodendron tulipifera GN=rpl2-B PE=3 SV=1 56 261 2.0E-19
sp|P56791|RK2_ARATH 50S ribosomal protein L2, chloroplastic OS=Arabidopsis thaliana GN=rpl2-A PE=3 SV=1 56 261 2.0E-19
sp|P60402|RL2_ONYPE 50S ribosomal protein L2 OS=Onion yellows phytoplasma (strain OY-M) GN=rplB PE=3 SV=1 75 280 2.0E-19
sp|B2IK65|RL2_BEII9 50S ribosomal protein L2 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rplB PE=3 SV=1 76 258 2.0E-19
sp|A7GK23|RL2_BACCN 50S ribosomal protein L2 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rplB PE=3 SV=1 75 275 2.0E-19
sp|A6Q1I1|RL2_NITSB 50S ribosomal protein L2 OS=Nitratiruptor sp. (strain SB155-2) GN=rplB PE=3 SV=1 56 261 2.0E-19
sp|Q1GK31|RL2_RUEST 50S ribosomal protein L2 OS=Ruegeria sp. (strain TM1040) GN=rplB PE=3 SV=1 76 258 3.0E-19
sp|A9NED6|RL2_ACHLI 50S ribosomal protein L2 OS=Acholeplasma laidlawii (strain PG-8A) GN=rplB PE=3 SV=1 72 288 3.0E-19
sp|B8G6S2|RL2_CHLAD 50S ribosomal protein L2 OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rplB PE=3 SV=1 76 262 3.0E-19
sp|Q6G2W8|RL2_BARHE 50S ribosomal protein L2 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rplB PE=3 SV=1 76 258 3.0E-19
sp|Q8D209|RL2_WIGBR 50S ribosomal protein L2 OS=Wigglesworthia glossinidia brevipalpis GN=rplB PE=3 SV=1 75 268 3.0E-19
sp|Q890P1|RL2_CLOTE 50S ribosomal protein L2 OS=Clostridium tetani (strain Massachusetts / E88) GN=rplB PE=3 SV=2 72 275 3.0E-19
sp|A8SEE5|RK2_CERDE 50S ribosomal protein L2, chloroplastic OS=Ceratophyllum demersum GN=rpl2-A PE=3 SV=1 56 261 3.0E-19
sp|B5Y985|RL2_COPPD 50S ribosomal protein L2 OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=rplB PE=3 SV=1 75 275 3.0E-19
sp|Q09WV5|RK2_MORIN 50S ribosomal protein L2, chloroplastic OS=Morus indica GN=rpl2-A PE=3 SV=1 37 261 3.0E-19
sp|A9VP80|RL2_BACWK 50S ribosomal protein L2 OS=Bacillus weihenstephanensis (strain KBAB4) GN=rplB PE=3 SV=1 75 275 3.0E-19
sp|Q9Z9L1|RL2_BACHD 50S ribosomal protein L2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rplB PE=3 SV=1 75 275 3.0E-19
sp|Q6ENS1|RK2_SACOF 50S ribosomal protein L2, chloroplastic OS=Saccharum officinarum GN=rpl2-A PE=3 SV=1 56 261 3.0E-19
sp|Q6L3B9|RK2_SACHY 50S ribosomal protein L2, chloroplastic OS=Saccharum hybrid GN=rpl2-A PE=2 SV=1 56 261 3.0E-19
sp|A7H108|RL2_CAMC5 50S ribosomal protein L2 OS=Campylobacter curvus (strain 525.92) GN=rplB PE=3 SV=1 76 261 3.0E-19
sp|Q73PM9|RL2_TREDE 50S ribosomal protein L2 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rplB PE=3 SV=1 75 257 3.0E-19
sp|A4QL60|RK2_DRANE 50S ribosomal protein L2, chloroplastic OS=Draba nemorosa GN=rpl2-A PE=3 SV=1 76 261 3.0E-19
sp|A8F2E4|RL2_RICM5 50S ribosomal protein L2 OS=Rickettsia massiliae (strain Mtu5) GN=rplB PE=3 SV=1 76 258 3.0E-19
sp|Q046C2|RL2_LACGA 50S ribosomal protein L2 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rplB PE=3 SV=1 75 261 4.0E-19
sp|Q04C12|RL2_LACDB 50S ribosomal protein L2 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rplB PE=3 SV=1 75 261 4.0E-19
sp|Q1GBL5|RL2_LACDA 50S ribosomal protein L2 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rplB PE=3 SV=1 75 261 4.0E-19
sp|A4QLE7|RK2_LEPVR 50S ribosomal protein L2, chloroplastic OS=Lepidium virginicum GN=rpl2-A PE=3 SV=1 76 261 4.0E-19
sp|B0JI00|RL2_MICAN 50S ribosomal protein L2 OS=Microcystis aeruginosa (strain NIES-843) GN=rplB PE=3 SV=1 76 262 4.0E-19
sp|P17788|RK2_MAIZE 50S ribosomal protein L2, chloroplastic OS=Zea mays GN=rpl2-A PE=2 SV=2 56 261 4.0E-19
sp|Q134T2|RL2_RHOPS 50S ribosomal protein L2 OS=Rhodopseudomonas palustris (strain BisB5) GN=rplB PE=3 SV=1 76 258 4.0E-19
sp|A4QKE6|RK2_BARVE 50S ribosomal protein L2, chloroplastic OS=Barbarea verna GN=rpl2-A PE=3 SV=1 76 261 4.0E-19
sp|A4QLN5|RK2_LOBMA 50S ribosomal protein L2, chloroplastic OS=Lobularia maritima GN=rpl2-A PE=3 SV=1 76 261 4.0E-19
sp|A4QK59|RK2_ARAHI 50S ribosomal protein L2, chloroplastic OS=Arabis hirsuta GN=rpl2-A PE=3 SV=1 76 261 4.0E-19
sp|Q7YJT7|RK2_CALFG 50S ribosomal protein L2, chloroplastic OS=Calycanthus floridus var. glaucus GN=rpl2 PE=3 SV=1 56 261 4.0E-19
sp|P27107|RK2_SINAL 50S ribosomal protein L2, chloroplastic OS=Sinapis alba GN=rpl2 PE=3 SV=1 76 261 4.0E-19
sp|Q06FM3|RK2_PELHO 50S ribosomal protein L2, chloroplastic OS=Pelargonium hortorum GN=rpl2-A PE=3 SV=1 27 261 4.0E-19
sp|A1XGS8|RK2_RANMC 50S ribosomal protein L2, chloroplastic OS=Ranunculus macranthus GN=rpl2-A PE=3 SV=1 76 261 4.0E-19
sp|A6X0C1|RL2_OCHA4 50S ribosomal protein L2 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rplB PE=3 SV=1 76 258 5.0E-19
sp|P11534|RK2_WHEAT 50S ribosomal protein L2, chloroplastic OS=Triticum aestivum GN=rpl2-A PE=3 SV=2 57 261 5.0E-19
sp|Q2IXQ7|RL2_RHOP2 50S ribosomal protein L2 OS=Rhodopseudomonas palustris (strain HaA2) GN=rplB PE=3 SV=1 76 258 5.0E-19
sp|A9IW24|RL2_BART1 50S ribosomal protein L2 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rplB PE=3 SV=1 76 258 5.0E-19
sp|B3CT08|RL2_ORITI 50S ribosomal protein L2 OS=Orientia tsutsugamushi (strain Ikeda) GN=rplB PE=3 SV=1 76 258 5.0E-19
sp|B8GV55|RL2_THISH 50S ribosomal protein L2 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=rplB PE=3 SV=1 75 268 5.0E-19
sp|B6JET6|RL2_OLICO 50S ribosomal protein L2 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rplB PE=3 SV=1 76 258 6.0E-19
sp|P06379|RK2_TOBAC 50S ribosomal protein L2, chloroplastic OS=Nicotiana tabacum GN=rpl2-A PE=3 SV=1 56 261 6.0E-19
sp|Q33BZ0|RK2_NICTO 50S ribosomal protein L2, chloroplastic OS=Nicotiana tomentosiformis GN=rpl2-A PE=3 SV=1 56 261 6.0E-19
sp|Q3C1N6|RK2_NICSY 50S ribosomal protein L2, chloroplastic OS=Nicotiana sylvestris GN=rpl2-A PE=3 SV=1 56 261 6.0E-19
sp|Q2GL56|RL2_ANAPZ 50S ribosomal protein L2 OS=Anaplasma phagocytophilum (strain HZ) GN=rplB PE=3 SV=1 76 258 6.0E-19
sp|Q589A7|RK2_SILLA 50S ribosomal protein L2, chloroplastic OS=Silene latifolia GN=rpl2 PE=3 SV=1 37 261 6.0E-19
sp|Q2VEB7|RK2_SOLTU 50S ribosomal protein L2, chloroplastic OS=Solanum tuberosum GN=rpl2-A PE=3 SV=1 37 261 6.0E-19
sp|Q2MI59|RK2_SOLLC 50S ribosomal protein L2, chloroplastic OS=Solanum lycopersicum GN=rpl2-A PE=3 SV=1 37 261 6.0E-19
sp|Q2MIE6|RK2_SOLBU 50S ribosomal protein L2, chloroplastic OS=Solanum bulbocastanum GN=rpl2-A PE=3 SV=1 37 261 6.0E-19
sp|Q8S8V3|RK2A_ATRBE 50S ribosomal protein L2-A, chloroplastic OS=Atropa belladonna GN=rpl2-A PE=3 SV=1 37 261 6.0E-19
sp|Q07KM1|RL2_RHOP5 50S ribosomal protein L2 OS=Rhodopseudomonas palustris (strain BisA53) GN=rplB PE=3 SV=1 76 258 6.0E-19
sp|B9E9J4|RL2_MACCJ 50S ribosomal protein L2 OS=Macrococcus caseolyticus (strain JCSC5402) GN=rplB PE=3 SV=1 75 275 6.0E-19
sp|Q09FY3|RK2_PLAOC 50S ribosomal protein L2, chloroplastic OS=Platanus occidentalis GN=rpl2-A PE=3 SV=1 37 261 6.0E-19
sp|P34768|RK2_EUGLO 50S ribosomal protein L2, plastid OS=Euglena longa GN=rpl2 PE=3 SV=1 76 261 6.0E-19
sp|B3QBX7|RL2_RHOPT 50S ribosomal protein L2 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rplB PE=3 SV=1 76 258 6.0E-19
sp|P60403|RL2_RHOPA 50S ribosomal protein L2 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rplB PE=1 SV=1 76 258 6.0E-19
sp|A5FZW2|RL2_ACICJ 50S ribosomal protein L2 OS=Acidiphilium cryptum (strain JF-5) GN=rplB PE=3 SV=1 76 257 6.0E-19
sp|Q8G079|RL2_BRUSU 50S ribosomal protein L2 OS=Brucella suis biovar 1 (strain 1330) GN=rplB PE=3 SV=1 76 258 6.0E-19
sp|C0RJJ8|RL2_BRUMB 50S ribosomal protein L2 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rplB PE=3 SV=1 76 258 6.0E-19
sp|Q57CR1|RL2_BRUAB 50S ribosomal protein L2 OS=Brucella abortus biovar 1 (strain 9-941) GN=rplB PE=3 SV=1 76 258 6.0E-19
sp|Q2YM06|RL2_BRUA2 50S ribosomal protein L2 OS=Brucella abortus (strain 2308) GN=rplB PE=3 SV=1 76 258 6.0E-19
sp|B2S676|RL2_BRUA1 50S ribosomal protein L2 OS=Brucella abortus (strain S19) GN=rplB PE=3 SV=1 76 258 6.0E-19
sp|P56367|RK2_CHLVU 50S ribosomal protein L2, chloroplastic OS=Chlorella vulgaris GN=rpl2 PE=3 SV=1 76 275 6.0E-19
sp|A0A377|RK2A_COFAR 50S ribosomal protein L2-A, chloroplastic OS=Coffea arabica GN=rpl2-A PE=3 SV=1 37 261 7.0E-19
sp|B7J246|RL2_BORBZ 50S ribosomal protein L2 OS=Borrelia burgdorferi (strain ZS7) GN=rplB PE=3 SV=1 75 258 7.0E-19
sp|P94270|RL2_BORBU 50S ribosomal protein L2 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rplB PE=3 SV=2 75 258 7.0E-19
sp|Q65PA4|RL2_BACLD 50S ribosomal protein L2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rplB PE=3 SV=1 75 275 7.0E-19
sp|Q9PQQ7|RL2_UREPA 50S ribosomal protein L2 OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=rplB PE=3 SV=1 75 261 7.0E-19
sp|B1AIM3|RL2_UREP2 50S ribosomal protein L2 OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=rplB PE=3 SV=1 75 261 7.0E-19
sp|Q87T10|RL2_VIBPA 50S ribosomal protein L2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rplB PE=3 SV=1 76 258 7.0E-19
sp|B2TIH8|RL2_CLOBB 50S ribosomal protein L2 OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=rplB PE=3 SV=1 75 275 7.0E-19
sp|B2UYB3|RL2_CLOBA 50S ribosomal protein L2 OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=rplB PE=3 SV=1 75 275 7.0E-19
sp|A6LPR4|RL2_CLOB8 50S ribosomal protein L2 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rplB PE=3 SV=1 75 275 7.0E-19
sp|Q661D9|RL2_BORBP 50S ribosomal protein L2 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rplB PE=3 SV=1 75 258 7.0E-19
sp|Q4G362|RK2_EMIHU 50S ribosomal protein L2, chloroplastic OS=Emiliania huxleyi GN=rpl2 PE=3 SV=1 75 289 8.0E-19
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0008152 metabolic process No
GO:1990904 ribonucleoprotein complex No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0043604 amide biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0044267 cellular protein metabolic process No
GO:0006518 peptide metabolic process No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0043226 organelle No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0005198 structural molecule activity No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0009058 biosynthetic process No
GO:0043229 intracellular organelle No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0043228 non-membrane-bounded organelle No
GO:0043043 peptide biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|880
MAFAWLPGGSTGSRTQKIVDIRICTPKHQAAEASGHSNDCIGSERAAMGRVIRNQRKGRGSIFTANTRLNKAPAK
FRNLDYAERHGYLRGVVREIVHDPGRGAPLAKVVFRHPYRFKQVTETFIANEGMYTGQFIYAGKKAALTVGNVLP
LGEMPEGTVVSNVEEKIGDRGVLGRTSGGYITVIGHNPDEGKTRIKLPSGAKKVVHSSSRGMIGIVAGGGRTDKP
LLKASRAKHKFAVKRNCWPKTRGVAMNPVDHPHGGGNHQHIGKASTISRYAAQGQKAGLIAARRTGLLRGTQKTK
E*
Coding >Hirsu2|880
ATGGCATTTGCCTGGCTCCCTGGTGGCTCGACCGGGTCCCGCACACAAAAAATTGTCGACATTCGCATCTGCACG
CCCAAACACCAAGCGGCCGAAGCCAGCGGACACTCGAACGATTGCATCGGGTCAGAACGAGCCGCCATGGGTAGA
GTCATTCGCAACCAGCGCAAGGGGCGTGGATCCATCTTCACTGCCAACACGCGCCTGAACAAGGCCCCGGCCAAG
TTCCGCAACCTCGATTACGCCGAGCGCCATGGCTACCTTCGTGGAGTAGTCCGCGAGATCGTTCACGACCCCGGT
CGTGGCGCGCCCCTGGCCAAGGTCGTCTTCCGCCACCCGTACCGGTTCAAGCAGGTCACCGAGACCTTCATCGCG
AACGAGGGCATGTACACCGGCCAATTCATCTACGCCGGGAAGAAGGCCGCCTTGACTGTCGGCAACGTGCTGCCC
CTCGGCGAGATGCCCGAGGGTACCGTCGTCTCCAACGTCGAGGAGAAGATTGGCGATCGCGGCGTCCTGGGCCGT
ACCTCGGGCGGCTACATCACCGTCATTGGCCACAACCCCGATGAAGGCAAAACCCGCATCAAGCTGCCGTCCGGC
GCGAAGAAGGTCGTCCACTCCAGCTCCCGAGGCATGATCGGCATCGTTGCCGGTGGTGGCCGAACAGACAAGCCC
CTGCTGAAGGCTTCGCGCGCCAAGCACAAGTTCGCCGTCAAGCGCAACTGCTGGCCCAAGACTCGTGGTGTTGCC
ATGAACCCCGTGGACCATCCCCACGGTGGTGGTAACCACCAACATATCGGCAAGGCGTCGACCATTTCTCGCTAT
GCTGCGCAAGGTCAAAAGGCCGGTCTTATTGCCGCAAGAAGGACGGGTCTCCTGCGTGGTACACAAAAGACGAAG
GAGTAG
Transcript >Hirsu2|880
ATGGCATTTGCCTGGCTCCCTGGTGGCTCGACCGGGTCCCGCACACAAAAAATTGTCGACATTCGCATCTGCACG
CCCAAACACCAAGCGGCCGAAGCCAGCGGACACTCGAACGATTGCATCGGGTCAGAACGAGCCGCCATGGGTAGA
GTCATTCGCAACCAGCGCAAGGGGCGTGGATCCATCTTCACTGCCAACACGCGCCTGAACAAGGCCCCGGCCAAG
TTCCGCAACCTCGATTACGCCGAGCGCCATGGCTACCTTCGTGGAGTAGTCCGCGAGATCGTTCACGACCCCGGT
CGTGGCGCGCCCCTGGCCAAGGTCGTCTTCCGCCACCCGTACCGGTTCAAGCAGGTCACCGAGACCTTCATCGCG
AACGAGGGCATGTACACCGGCCAATTCATCTACGCCGGGAAGAAGGCCGCCTTGACTGTCGGCAACGTGCTGCCC
CTCGGCGAGATGCCCGAGGGTACCGTCGTCTCCAACGTCGAGGAGAAGATTGGCGATCGCGGCGTCCTGGGCCGT
ACCTCGGGCGGCTACATCACCGTCATTGGCCACAACCCCGATGAAGGCAAAACCCGCATCAAGCTGCCGTCCGGC
GCGAAGAAGGTCGTCCACTCCAGCTCCCGAGGCATGATCGGCATCGTTGCCGGTGGTGGCCGAACAGACAAGCCC
CTGCTGAAGGCTTCGCGCGCCAAGCACAAGTTCGCCGTCAAGCGCAACTGCTGGCCCAAGACTCGTGGTGTTGCC
ATGAACCCCGTGGACCATCCCCACGGTGGTGGTAACCACCAACATATCGGCAAGGCGTCGACCATTTCTCGCTAT
GCTGCGCAAGGTCAAAAGGCCGGTCTTATTGCCGCAAGAAGGACGGGTCTCCTGCGTGGTACACAAAAGACGAAG
GAGTAG
Gene >Hirsu2|880
ATGGCATTTGCCTGTACACGCTACTACTGGCAGTACCTGTACCAGCACTTACATACACTCCGAGATCACGTGGTC
AGGGCTCCCTGGTGGCTCGACCGGGTCCCGCACACAAAAAATTGTCGACATTCGCATCTGCACGCCCAAACACCA
AGCGGCCGAAGCCAGGTAAAAATTTCCCACCCTCGCGGCGTCGGCGACCTGCCACTGACAGCCATTGGCATAGCG
GACACTCGAACGATTGCATCGGGTCAGAACGAGCCGCCATGGGTAGAGTCATTCGCAACCAGCGCAAGGGGCGTG
GATCCATCTTCAGTCAGTCGCGCCATCGCGCCTTGGACGGCGATGCGGAGACCAGTGGTTAACTGTCGACGATAG
CTGCCAACACGCGCCTGAACAAGGCCCCGGCCAAGTTCCGCAACCTCGATTACGCCGAGCGCCATGGCTACCTTC
GTGGAGTAGTCCGCGAGATCGTTCACGACCCCGGTTAGTTTGACGTCGACGCATTGCAGGAGCCGAGGAGACGGG
ACGAGGGCTGACGATGGGTGGAATTGCAGGTCGTGGCGCGCCCCTGGCCAAGGTCGTCTTCCGCCACCCGTACCG
GTTCAAGCAGGTCACCGAGACCTTCATCGCGAACGAGGGCATGTACACCGGCCAATTCATCTACGCCGGGAAGAA
GGCCGCCTTGACTGTCGGCAACGTGCTGCCCCTCGGCGAGATGCCCGAGGGTACCGTCGTCTCCAACGTCGAGGA
GAAGATTGGCGATCGCGGCGTCCTGGGCCGTACCTCGGGCGGCTACATCACCGTCATTGGCCACAACCCCGATGA
AGGCAAAACCCGCATCAAGCTGCCGTCCGGCGCGAAGAAGGTCGTCCACTCCAGCTCCCGAGGCATGATCGGCAT
CGTTGCCGGTGGTGGCCGAACAGACAAGCCCCTGCTGAGTAGGTTTCTGCCCTGGAGCCTTGACGGTTGAGAGAG
AGGTTCTAACGTCGGCCGCAGAGGCTTCGCGCGCCAAGCACAAGTTCGCCGTCAAGCGCAACTGCTGGCCCAAGA
CTCGTGGTGTTGCCATGAACCCCGTGGACCATCCCCACGGTGGTGTAAGTGGTCCCAGGATGCTCGGGGCGCGGG
TGACGGAAACTGACAAGCACGACAGGGTAACCACCAACATATCGGCAAGGCGTCGACCATTTCTCGCTATGCTGC
GCAAGGTCAAAAGGCCGGTCTTATTGCCGCAAGAAGGACGGGTCTCCTGCGTGGTACACAAAAGACGAAGGAGTA
G

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail