Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8775
Gene name
LocationContig_597:8060..9495
Strand+
Gene length (bp)1435
Transcript length (bp)1242
Coding sequence length (bp)1242
Protein length (aa) 414

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.3E-15 1 147
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 7.3E-06 2 207

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 1 229 2.0E-16
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 1 401 2.0E-16
sp|P25594|VBA3_YEAST Vacuolar basic amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA3 PE=1 SV=1 34 401 1.0E-13
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 1 223 1.0E-13
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 1 202 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 1 229 2.0E-16
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 1 401 2.0E-16
sp|P25594|VBA3_YEAST Vacuolar basic amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA3 PE=1 SV=1 34 401 1.0E-13
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 1 223 1.0E-13
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 1 202 2.0E-13
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 1 181 2.0E-12
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 2 231 6.0E-12
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 35 201 1.0E-11
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 35 201 1.0E-11
sp|P50080|AZR1_YEAST Azole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZR1 PE=1 SV=1 1 326 2.0E-10
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 1 185 5.0E-10
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 12 326 3.0E-08
sp|P44903|HSRA_HAEIN Probable transport protein HsrA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hsrA PE=3 SV=1 2 114 4.0E-08
sp|P38724|ARN2_YEAST Siderophore iron transporter ARN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN2 PE=3 SV=2 1 237 3.0E-07
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 1 201 7.0E-07
sp|Q08299|ENB1_YEAST Siderophore iron transporter ENB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENB1 PE=1 SV=1 1 202 1.0E-06
sp|Q6D2A9|MDTD_PECAS Putative multidrug resistance protein MdtD OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mdtD PE=3 SV=1 1 114 4.0E-06
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 3 372 5.0E-06
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 3 372 5.0E-06
sp|P25596|GEX1_YEAST Glutathione exchanger 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX1 PE=1 SV=4 1 232 7.0E-06
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 1 370 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 9 31 22
2 36 58 22
3 71 93 22
4 97 119 22
5 157 179 22
6 183 205 22
7 226 248 22
8 258 280 22
9 285 307 22
10 317 339 22
11 346 368 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8775
MADVFGRYASILAAVLIMLLGSGICTGAPTYAYGVLLLGRGFQGLACAGLNIIVRTILADRVTLRENAKNWSIFA
LVGGVSYGLGPVIGGYLTKANWRWCFGINLPVGALALLAIVIMLRKELLGPQPIRELDETDETGWRAHFVTRLKT
IDVAGQALFISGFGLIILALTWGGVTYPWKSAAVIIPLLVGSLLAGCFFLWERVLRPGRTEPKWMTRQRPMIPWI
LLSNRDIGIIFYSECANGMAMFAGNSSDKAGLQLLYFTPGLGVGVYLCAFLCNRWPRMTFPPLFISTAVEAIGIG
VLAVALHAEQKGTIFGMMALVGVGTGLRFMVAPLHGIGIFNAHRASIIGLMAVATPLGGTVGLAIMSAVFNNVSG
LDTKAIDFSALRTQSAGMEEQTILNIEVRAPRLLARRI*
Coding >Hirsu2|8775
ATGGCCGACGTGTTTGGTCGATACGCATCGATCCTTGCCGCCGTCTTAATCATGCTGCTTGGCAGCGGCATCTGC
ACTGGCGCGCCGACATATGCGTACGGAGTCCTTCTCCTGGGGCGTGGCTTCCAGGGTCTGGCGTGCGCTGGCCTC
AACATCATCGTCCGTACCATCCTCGCCGATCGTGTGACGCTTCGAGAGAACGCCAAGAACTGGTCTATATTCGCT
CTTGTGGGAGGAGTCTCGTACGGGTTAGGGCCCGTCATCGGGGGCTACCTCACCAAGGCCAACTGGCGATGGTGT
TTCGGCATCAACTTGCCCGTCGGGGCTCTGGCCCTCCTAGCAATCGTCATCATGCTGCGCAAGGAGCTTCTCGGC
CCGCAGCCCATTCGCGAACTCGACGAGACCGACGAGACGGGGTGGAGAGCCCACTTTGTTACGCGCCTCAAGACC
ATTGACGTGGCAGGACAGGCCCTCTTTATCTCTGGCTTCGGCCTTATCATCCTAGCCCTCACTTGGGGTGGCGTG
ACATATCCGTGGAAATCTGCCGCTGTCATCATCCCGCTGCTTGTCGGGTCCTTGCTCGCTGGGTGCTTCTTCCTC
TGGGAGCGCGTGCTTCGCCCTGGGCGAACCGAGCCCAAGTGGATGACACGGCAACGGCCCATGATTCCCTGGATC
CTGCTGTCCAACCGGGACATTGGCATCATCTTCTACTCAGAGTGCGCTAACGGCATGGCCATGTTTGCTGGGAAC
TCCTCGGACAAGGCTGGCCTGCAGCTTTTGTACTTTACTCCTGGCTTGGGAGTTGGCGTCTATCTGTGTGCCTTT
CTGTGCAACCGCTGGCCGAGGATGACGTTTCCCCCCCTCTTCATCAGCACCGCCGTCGAGGCGATCGGCATAGGG
GTCCTCGCGGTAGCTCTGCACGCGGAGCAGAAGGGGACGATATTCGGTATGATGGCCCTGGTCGGTGTCGGCACG
GGGCTTCGGTTCATGGTGGCTCCGCTGCACGGCATCGGCATCTTCAACGCCCACCGGGCCTCCATCATCGGGCTG
ATGGCGGTCGCAACTCCACTGGGAGGGACTGTCGGCCTGGCCATCATGTCCGCCGTCTTCAACAACGTCTCCGGG
CTGGACACGAAGGCCATCGACTTTTCGGCGCTGCGGACCCAGTCTGCAGGCATGGAGGAGCAGACGATCCTCAAC
ATTGAGGTGCGGGCTCCCAGATTGCTGGCCCGTCGAATTTAA
Transcript >Hirsu2|8775
ATGGCCGACGTGTTTGGTCGATACGCATCGATCCTTGCCGCCGTCTTAATCATGCTGCTTGGCAGCGGCATCTGC
ACTGGCGCGCCGACATATGCGTACGGAGTCCTTCTCCTGGGGCGTGGCTTCCAGGGTCTGGCGTGCGCTGGCCTC
AACATCATCGTCCGTACCATCCTCGCCGATCGTGTGACGCTTCGAGAGAACGCCAAGAACTGGTCTATATTCGCT
CTTGTGGGAGGAGTCTCGTACGGGTTAGGGCCCGTCATCGGGGGCTACCTCACCAAGGCCAACTGGCGATGGTGT
TTCGGCATCAACTTGCCCGTCGGGGCTCTGGCCCTCCTAGCAATCGTCATCATGCTGCGCAAGGAGCTTCTCGGC
CCGCAGCCCATTCGCGAACTCGACGAGACCGACGAGACGGGGTGGAGAGCCCACTTTGTTACGCGCCTCAAGACC
ATTGACGTGGCAGGACAGGCCCTCTTTATCTCTGGCTTCGGCCTTATCATCCTAGCCCTCACTTGGGGTGGCGTG
ACATATCCGTGGAAATCTGCCGCTGTCATCATCCCGCTGCTTGTCGGGTCCTTGCTCGCTGGGTGCTTCTTCCTC
TGGGAGCGCGTGCTTCGCCCTGGGCGAACCGAGCCCAAGTGGATGACACGGCAACGGCCCATGATTCCCTGGATC
CTGCTGTCCAACCGGGACATTGGCATCATCTTCTACTCAGAGTGCGCTAACGGCATGGCCATGTTTGCTGGGAAC
TCCTCGGACAAGGCTGGCCTGCAGCTTTTGTACTTTACTCCTGGCTTGGGAGTTGGCGTCTATCTGTGTGCCTTT
CTGTGCAACCGCTGGCCGAGGATGACGTTTCCCCCCCTCTTCATCAGCACCGCCGTCGAGGCGATCGGCATAGGG
GTCCTCGCGGTAGCTCTGCACGCGGAGCAGAAGGGGACGATATTCGGTATGATGGCCCTGGTCGGTGTCGGCACG
GGGCTTCGGTTCATGGTGGCTCCGCTGCACGGCATCGGCATCTTCAACGCCCACCGGGCCTCCATCATCGGGCTG
ATGGCGGTCGCAACTCCACTGGGAGGGACTGTCGGCCTGGCCATCATGTCCGCCGTCTTCAACAACGTCTCCGGG
CTGGACACGAAGGCCATCGACTTTTCGGCGCTGCGGACCCAGTCTGCAGGCATGGAGGAGCAGACGATCCTCAAC
ATTGAGGTGCGGGCTCCCAGATTGCTGGCCCGTCGAATTTAA
Gene >Hirsu2|8775
ATGGCCGACGTGTTTGGTCGATACGCATCGATCCTTGCCGCCGTCTTAATCATGCTGCTTGGCAGCGGCATCTGC
ACTGGCGCGCCGACATATGCGTACGGAGTCCTTCTCCTGGGGCGTGGCTTCCAGGGTCTGGCGTGCGCTGGCCTC
AACATCATCGTCCGTACCATCCTCGCCGATCGTGTGACGCTTCGAGAGAACGCCAAGAACTGGTCTATATTCGCT
CTTGTGGGAGGAGTCTCGTACGGGTTAGGGCCCGTCATCGGGGGCTACCTCACCAAGGCCAACTGGCGATGGTGT
TTCGGCATCAACTTGCCCGTCGGGGCTCTGGCCCTCCTAGCAATCGTCATCATGCTGCGCAAGGAGCTTCTCGGC
CCGCAGCCCATTCGCGAACTCGACGAGACCGACGAGACGGGGTGGAGAGCCCACTTTGTTACGCGCCTCAAGACC
ATTGACGTGGCAGGACAGGCCCTCTTTATCTCTGGCTTCGGCCTTATCATCCTAGCCCTCACTTGGGGTGGCGTG
ACATATCCGTGGAAATCTGCCGCTGTCATCATCCCGCTGCTTGTCGGGTCCTTGCTCGCTGGGTGCTTCTTCCTC
TGGGAGCGCGTGCTTCGCCCTGGGCGAACCGAGCCCAAGTGGATGACACGGCAACGGCCCATGATTCCCTGGATC
CTGCTGTCCAACCGGGACATTGGCATCATCTTCTACTCAGAGTGCGCTAACGGCATGGCCATGTTTGCTGTAAGT
TGCTTCAGCTGCTTCAGAACTGCTTCTCTCTGACAGCCGCAGGTACTGTATTTCTGCAATATCTATTTCATCGCA
GTCATGGTAGGACGGGCGCCCCTCGACCAGTCGTGCTCCTCGCTTACGCACTATTTTTAGGGGAACTCCTCGGAC
AAGGCTGGCCTGCAGCTTTTGTACTTTACTCCTGGCTTGGGAGGTATGGCTTAGCACCGCCTTATCGTGTTGCTT
TCTGACCGAGTTTGATGCAGTTGGCGTCTATCTGTGTGCCTTTCTGTGCAACCGCTGGCCGAGGATGACGTTTCC
CCCCCTCTTCATCAGCACCGCCGTCGAGGCGATCGGCATAGGGGTCCTCGCGGTAGCTCTGCACGCGGAGCAGAA
GGGGACGATATTCGGTATGATGGCCCTGGTCGGTGTCGGCACGGGGCTTCGGTTCATGGTGGCTCCGCTGCACGG
CATCGGCATCTTCAACGCCCACCGGGCCTCCATCATCGGGCTGATGGCGGTCGCAACTCCACTGGGAGGGACTGT
CGGCCTGGCCATCATGTCCGCCGTCTTCAACAACGTCTCCGGGCTGGACACGAAGGCCATCGACTTTTCGGCGCT
GCGGACCCAGTCTGCAGGCATGGAGGAGCAGACGATCCTCAACATTGAGGTGCGGGCTCCCAGATTGCTGGCCCG
TCGAATTTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail