Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8772
Gene name
LocationContig_596:12504..14152
Strand+
Gene length (bp)1648
Transcript length (bp)1434
Coding sequence length (bp)1434
Protein length (aa) 478

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08595 RXT2_N RXT2-like, N-terminal 1.5E-44 37 177

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3305 0.9265 0.0792 0.0502 0.0913 0.006 0.0365 0.0195 0.0111 0.0303

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6295
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3946
Ophiocordyceps australis map64 (Brazil) OphauB2|489
Ophiocordyceps camponoti-floridani Ophcf2|01233
Ophiocordyceps kimflemingae Ophio5|3869
Ophiocordyceps subramaniannii Hirsu2|8772 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8772
MASQQILFAETVAGMKKAFKRKAYESDSDSDIENYGNRGNKLKKRARFARQGQLAPTQGPSAYKESVQFAGAPRA
ILHRNPPLVDEEGYEIDSEDDDERVEDAALAAAELNPYAHIRLEHLLAPLTASTDLPTHSTLSKPFVSKTLTNLV
SQSSQLMRRENQSLWRMRQLWTSLCGDGTWMPCGLMVGSDDISLYKEDHVAQHLLSLARANGADASPPTALNGDV
RREGPGGASDAGNRNGDSSRRPEEVRRAAEVLMMDVGAFSNGTGKSKQKEAARPQGPNGERPLDVRQGDGRGPYD
GPSAGGADEVMDAKKSGLRAERRQEDAMMRDAAEPTAHARADPRRTASSAASEASEQNFIHPLFLTPAGARPDRN
MGLPEHEAEDIRRLLGLYVQKQEEICRGATRLHHGLLRAERLRKDVLHWAKAEAHCGPNRDMSDGEDWYDKEEWG
LTEDLKKGQDEEEEDTTTTGKKTRNRR*
Coding >Hirsu2|8772
ATGGCGTCACAGCAGATCCTCTTCGCCGAAACGGTGGCCGGCATGAAGAAGGCTTTCAAGCGGAAGGCCTACGAG
TCCGACTCTGACTCCGACATTGAAAACTACGGCAACCGCGGCAACAAGCTGAAGAAGAGGGCGCGGTTCGCGCGT
CAGGGGCAATTGGCGCCCACCCAGGGACCCAGCGCATACAAGGAGTCTGTCCAGTTCGCGGGCGCGCCGAGAGCC
ATCCTCCACCGAAATCCGCCGCTAGTCGACGAGGAGGGCTACGAAATCGACAGCGAGGACGACGACGAGCGCGTC
GAGGACGCCGCTCTGGCAGCTGCTGAGCTCAACCCGTACGCCCACATTCGGTTGGAACATCTTCTGGCGCCCTTG
ACCGCGTCGACCGACCTGCCCACTCACTCGACCCTTTCGAAACCGTTCGTCTCCAAGACGCTCACAAATCTGGTC
TCGCAGAGCAGCCAACTCATGCGCAGAGAAAACCAATCTTTATGGCGGATGAGGCAACTCTGGACATCCCTCTGT
GGCGACGGCACCTGGATGCCGTGTGGGCTGATGGTTGGGTCGGACGACATCTCCCTGTACAAGGAGGATCATGTC
GCCCAACACCTCCTGAGTCTGGCGAGAGCAAACGGGGCCGACGCCTCGCCGCCGACAGCGTTGAATGGCGACGTC
CGGAGAGAAGGCCCCGGCGGCGCCAGCGATGCAGGAAACCGGAACGGTGACAGCTCGAGGCGGCCGGAGGAGGTG
CGACGCGCCGCCGAAGTGCTGATGATGGACGTGGGCGCGTTCAGCAACGGCACTGGCAAATCGAAACAGAAAGAA
GCTGCGCGACCGCAAGGGCCCAACGGCGAAAGGCCCCTGGACGTTCGCCAAGGAGATGGGAGGGGCCCGTACGAT
GGACCTTCCGCCGGCGGGGCGGACGAGGTCATGGATGCCAAGAAGAGCGGACTGCGGGCGGAAAGGAGGCAAGAG
GACGCGATGATGAGGGACGCCGCCGAGCCGACGGCGCACGCTCGGGCGGACCCGCGAAGAACAGCCTCGTCGGCG
GCTTCAGAGGCTTCGGAACAAAACTTCATCCACCCCTTGTTTCTGACACCGGCGGGCGCCAGGCCAGATCGCAAT
ATGGGCCTGCCGGAGCACGAAGCAGAGGACATCCGGAGACTGCTCGGTCTCTACGTGCAGAAGCAGGAAGAGATC
TGCCGAGGAGCAACGCGACTGCATCACGGCCTGCTGAGAGCGGAGCGGCTGCGGAAGGACGTGCTGCACTGGGCC
AAGGCCGAGGCGCACTGCGGGCCGAACCGGGACATGTCGGACGGCGAGGACTGGTACGACAAGGAGGAATGGGGT
CTGACGGAAGATCTCAAGAAGGGGCAGGACGAGGAGGAGGAGGACACGACGACGACAGGCAAGAAGACGAGAAAC
CGCCGGTAG
Transcript >Hirsu2|8772
ATGGCGTCACAGCAGATCCTCTTCGCCGAAACGGTGGCCGGCATGAAGAAGGCTTTCAAGCGGAAGGCCTACGAG
TCCGACTCTGACTCCGACATTGAAAACTACGGCAACCGCGGCAACAAGCTGAAGAAGAGGGCGCGGTTCGCGCGT
CAGGGGCAATTGGCGCCCACCCAGGGACCCAGCGCATACAAGGAGTCTGTCCAGTTCGCGGGCGCGCCGAGAGCC
ATCCTCCACCGAAATCCGCCGCTAGTCGACGAGGAGGGCTACGAAATCGACAGCGAGGACGACGACGAGCGCGTC
GAGGACGCCGCTCTGGCAGCTGCTGAGCTCAACCCGTACGCCCACATTCGGTTGGAACATCTTCTGGCGCCCTTG
ACCGCGTCGACCGACCTGCCCACTCACTCGACCCTTTCGAAACCGTTCGTCTCCAAGACGCTCACAAATCTGGTC
TCGCAGAGCAGCCAACTCATGCGCAGAGAAAACCAATCTTTATGGCGGATGAGGCAACTCTGGACATCCCTCTGT
GGCGACGGCACCTGGATGCCGTGTGGGCTGATGGTTGGGTCGGACGACATCTCCCTGTACAAGGAGGATCATGTC
GCCCAACACCTCCTGAGTCTGGCGAGAGCAAACGGGGCCGACGCCTCGCCGCCGACAGCGTTGAATGGCGACGTC
CGGAGAGAAGGCCCCGGCGGCGCCAGCGATGCAGGAAACCGGAACGGTGACAGCTCGAGGCGGCCGGAGGAGGTG
CGACGCGCCGCCGAAGTGCTGATGATGGACGTGGGCGCGTTCAGCAACGGCACTGGCAAATCGAAACAGAAAGAA
GCTGCGCGACCGCAAGGGCCCAACGGCGAAAGGCCCCTGGACGTTCGCCAAGGAGATGGGAGGGGCCCGTACGAT
GGACCTTCCGCCGGCGGGGCGGACGAGGTCATGGATGCCAAGAAGAGCGGACTGCGGGCGGAAAGGAGGCAAGAG
GACGCGATGATGAGGGACGCCGCCGAGCCGACGGCGCACGCTCGGGCGGACCCGCGAAGAACAGCCTCGTCGGCG
GCTTCAGAGGCTTCGGAACAAAACTTCATCCACCCCTTGTTTCTGACACCGGCGGGCGCCAGGCCAGATCGCAAT
ATGGGCCTGCCGGAGCACGAAGCAGAGGACATCCGGAGACTGCTCGGTCTCTACGTGCAGAAGCAGGAAGAGATC
TGCCGAGGAGCAACGCGACTGCATCACGGCCTGCTGAGAGCGGAGCGGCTGCGGAAGGACGTGCTGCACTGGGCC
AAGGCCGAGGCGCACTGCGGGCCGAACCGGGACATGTCGGACGGCGAGGACTGGTACGACAAGGAGGAATGGGGT
CTGACGGAAGATCTCAAGAAGGGGCAGGACGAGGAGGAGGAGGACACGACGACGACAGGCAAGAAGACGAGAAAC
CGCCGGTAG
Gene >Hirsu2|8772
ATGGCGTCACAGCAGATCCTCTTCGCCGAAACGGTGGCCGGCATGAAGAAGGCTTTCAAGCGGAAGGCCTACGGT
GCGAAAGCTTTTCACACGTCGGATCCCCTTGGGCGATTTCGCTGACGCTGGCCGTCCTCCCAGAGTCCGACTCTG
ACTCCGACATTGAAAACTACGGCAACCGCGGCAACAAGCTGAAGAAGAGGGCGCGGTTCGCGCGTCAGGGGCAAT
TGGCGCCCACCCAGGGACCCAGCGCATACAAGGAGGTGAGACTGTCGCCCCCCGAGGCAACAACGGTCGCCCGGT
CTCGCCACCTCGGCCTCCCCAGCTTACCTCTCTACAGTCTGTCCAGTTCGCGGGCGCGCCGAGAGCCATCCTCCA
CCGAAATCCGCCGCTAGTCGACGAGGAGGGCTACGAAATCGACAGCGAGGACGACGACGAGCGCGTCGAGGACGC
CGCTCTGGCAGCTGCTGAGCTCAACCCGTACGCCCACATTCGGTTGGAACGTACGTCAAAAACCCATCCAAACCA
AACACGCCGACCTCGAGTCGAACGATCTGACGCGAAGAGACATACAGATCTTCTGGCGCCCTTGACCGCGTCGAC
CGACCTGCCCACTCACTCGACCCTTTCGAAACCGTTCGTCTCCAAGACGCTCACAAATCTGGTCTCGCAGAGCAG
CCAACTCATGCGCAGAGAAAACCAATCTTTATGGCGGATGAGGCAACTCTGGACATCCCTCTGTGGCGACGGCAC
CTGGATGCCGTGTGGGCTGATGGTTGGGTCGGACGACATCTCCCTGTACAAGGAGGATCATGTCGCCCAACACCT
CCTGAGTCTGGCGAGAGCAAACGGGGCCGACGCCTCGCCGCCGACAGCGTTGAATGGCGACGTCCGGAGAGAAGG
CCCCGGCGGCGCCAGCGATGCAGGAAACCGGAACGGTGACAGCTCGAGGCGGCCGGAGGAGGTGCGACGCGCCGC
CGAAGTGCTGATGATGGACGTGGGCGCGTTCAGCAACGGCACTGGCAAATCGAAACAGAAAGAAGCTGCGCGACC
GCAAGGGCCCAACGGCGAAAGGCCCCTGGACGTTCGCCAAGGAGATGGGAGGGGCCCGTACGATGGACCTTCCGC
CGGCGGGGCGGACGAGGTCATGGATGCCAAGAAGAGCGGACTGCGGGCGGAAAGGAGGCAAGAGGACGCGATGAT
GAGGGACGCCGCCGAGCCGACGGCGCACGCTCGGGCGGACCCGCGAAGAACAGCCTCGTCGGCGGCTTCAGAGGC
TTCGGAACAAAACTTCATCCACCCCTTGTTTCTGACACCGGCGGGCGCCAGGCCAGATCGCAATATGGGCCTGCC
GGAGCACGAAGCAGAGGACATCCGGAGACTGCTCGGTCTCTACGTGCAGAAGCAGGAAGAGATCTGCCGAGGAGC
AACGCGACTGCATCACGGCCTGCTGAGAGCGGAGCGGCTGCGGAAGGACGTGCTGCACTGGGCCAAGGCCGAGGC
GCACTGCGGGCCGAACCGGGACATGTCGGACGGCGAGGACTGGTACGACAAGGAGGAATGGGGTCTGACGGAAGA
TCTCAAGAAGGGGCAGGACGAGGAGGAGGAGGACACGACGACGACAGGCAAGAAGACGAGAAACCGCCGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail