Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8771
Gene name
LocationContig_596:8307..11521
Strand+
Gene length (bp)3214
Transcript length (bp)2811
Coding sequence length (bp)2811
Protein length (aa) 937

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain 6.7E-62 24 352

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40406|NAGZ_BACSU Beta-hexosaminidase OS=Bacillus subtilis (strain 168) GN=nagZ PE=1 SV=1 4 417 4.0E-41
sp|Q3SKU2|NAGZ_THIDA Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=nagZ PE=3 SV=1 32 332 2.0E-33
sp|P48823|HEXA_PSEO7 Beta-hexosaminidase A OS=Pseudoalteromonas piscicida GN=cht60 PE=1 SV=1 39 402 7.0E-31
sp|Q0A911|NAGZ_ALKEH Beta-hexosaminidase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=nagZ PE=3 SV=1 32 315 3.0E-30
sp|Q5FA94|NAGZ_NEIG1 Beta-hexosaminidase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=nagZ PE=3 SV=1 41 330 1.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40406|NAGZ_BACSU Beta-hexosaminidase OS=Bacillus subtilis (strain 168) GN=nagZ PE=1 SV=1 4 417 4.0E-41
sp|Q3SKU2|NAGZ_THIDA Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=nagZ PE=3 SV=1 32 332 2.0E-33
sp|P48823|HEXA_PSEO7 Beta-hexosaminidase A OS=Pseudoalteromonas piscicida GN=cht60 PE=1 SV=1 39 402 7.0E-31
sp|Q0A911|NAGZ_ALKEH Beta-hexosaminidase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=nagZ PE=3 SV=1 32 315 3.0E-30
sp|Q5FA94|NAGZ_NEIG1 Beta-hexosaminidase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=nagZ PE=3 SV=1 41 330 1.0E-29
sp|Q9HZK0|NAGZ_PSEAE Beta-hexosaminidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nagZ PE=3 SV=1 32 315 1.0E-29
sp|Q02PG9|NAGZ_PSEAB Beta-hexosaminidase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=nagZ PE=3 SV=1 32 315 1.0E-29
sp|B7UYS5|NAGZ_PSEA8 Beta-hexosaminidase OS=Pseudomonas aeruginosa (strain LESB58) GN=nagZ PE=3 SV=1 32 315 1.0E-29
sp|B4SRK3|NAGZ_STRM5 Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain R551-3) GN=nagZ PE=3 SV=1 31 330 1.0E-29
sp|Q9K0Q4|NAGZ_NEIMB Beta-hexosaminidase OS=Neisseria meningitidis serogroup B (strain MC58) GN=nagZ PE=3 SV=1 41 320 2.0E-29
sp|Q6LJ30|NAGZ_PHOPR Beta-hexosaminidase OS=Photobacterium profundum GN=nagZ PE=3 SV=1 38 328 2.0E-29
sp|B2FPW9|NAGZ_STRMK Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) GN=nagZ PE=3 SV=1 31 330 4.0E-29
sp|A9M1Z4|NAGZ_NEIM0 Beta-hexosaminidase OS=Neisseria meningitidis serogroup C (strain 053442) GN=nagZ PE=3 SV=1 41 320 7.0E-29
sp|Q9PAZ0|NAGZ_XYLFA Beta-hexosaminidase OS=Xylella fastidiosa (strain 9a5c) GN=nagZ PE=3 SV=1 31 315 8.0E-29
sp|Q2KXM7|NAGZ_BORA1 Beta-hexosaminidase OS=Bordetella avium (strain 197N) GN=nagZ PE=3 SV=1 38 330 2.0E-28
sp|Q9JVT3|NAGZ_NEIMA Beta-hexosaminidase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=nagZ PE=3 SV=1 41 320 2.0E-28
sp|Q87BR5|NAGZ_XYLFT Beta-hexosaminidase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=nagZ PE=3 SV=1 31 315 2.0E-28
sp|B2I6G9|NAGZ_XYLF2 Beta-hexosaminidase OS=Xylella fastidiosa (strain M23) GN=nagZ PE=3 SV=1 31 315 2.0E-28
sp|B4RQ67|NAGZ_NEIG2 Beta-hexosaminidase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=nagZ PE=3 SV=1 41 330 3.0E-28
sp|A1SW90|NAGZ_PSYIN Beta-hexosaminidase OS=Psychromonas ingrahamii (strain 37) GN=nagZ PE=3 SV=1 32 330 4.0E-28
sp|B0U3L0|NAGZ_XYLFM Beta-hexosaminidase OS=Xylella fastidiosa (strain M12) GN=nagZ PE=3 SV=1 31 315 4.0E-28
sp|A1KSD9|NAGZ_NEIMF Beta-hexosaminidase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=nagZ PE=3 SV=1 41 320 5.0E-28
sp|Q2Y863|NAGZ_NITMU Beta-hexosaminidase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=nagZ PE=3 SV=1 32 315 7.0E-28
sp|C3LSU7|NAGZ_VIBCM Beta-hexosaminidase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=nagZ PE=3 SV=1 17 361 9.0E-28
sp|Q9KU37|NAGZ_VIBCH Beta-hexosaminidase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=nagZ PE=1 SV=1 17 361 9.0E-28
sp|Q82SJ8|NAGZ_NITEU Beta-hexosaminidase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=nagZ PE=3 SV=1 32 328 1.0E-27
sp|A5F8Y1|NAGZ_VIBC3 Beta-hexosaminidase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=nagZ PE=3 SV=1 17 361 2.0E-27
sp|Q0AF74|NAGZ_NITEC Beta-hexosaminidase OS=Nitrosomonas eutropha (strain C91) GN=nagZ PE=3 SV=1 32 332 3.0E-27
sp|P96157|NAGZ_VIBFU Beta-hexosaminidase OS=Vibrio furnissii GN=nagZ PE=1 SV=2 17 315 4.0E-27
sp|C4LEY6|NAGZ_TOLAT Beta-hexosaminidase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=nagZ PE=3 SV=1 32 329 6.0E-27
sp|Q31G32|NAGZ_THICR Beta-hexosaminidase OS=Thiomicrospira crunogena (strain XCL-2) GN=nagZ PE=3 SV=1 32 315 7.0E-27
sp|Q1H075|NAGZ_METFK Beta-hexosaminidase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=nagZ PE=3 SV=1 38 329 7.0E-27
sp|B8F5N0|NAGZ_HAEPS Beta-hexosaminidase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=nagZ PE=3 SV=1 31 366 7.0E-27
sp|Q7VWV8|NAGZ_BORPE Beta-hexosaminidase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=nagZ PE=3 SV=1 38 348 2.0E-26
sp|Q7W9J5|NAGZ_BORPA Beta-hexosaminidase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=nagZ PE=3 SV=2 38 341 2.0E-26
sp|Q7WH65|NAGZ_BORBR Beta-hexosaminidase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=nagZ PE=3 SV=1 38 341 2.0E-26
sp|Q5QUZ5|NAGZ_IDILO Beta-hexosaminidase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=nagZ PE=3 SV=1 32 322 5.0E-26
sp|Q7N397|NAGZ_PHOLL Beta-hexosaminidase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=nagZ PE=3 SV=1 38 330 1.0E-25
sp|Q080R9|NAGZ_SHEFN Beta-hexosaminidase OS=Shewanella frigidimarina (strain NCIMB 400) GN=nagZ PE=3 SV=1 32 315 4.0E-25
sp|A0KXK3|NAGZ_SHESA Beta-hexosaminidase OS=Shewanella sp. (strain ANA-3) GN=nagZ PE=3 SV=1 40 315 9.0E-25
sp|Q5H1Q0|NAGZ_XANOR Beta-hexosaminidase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=nagZ PE=3 SV=2 31 330 1.0E-24
sp|Q0HJG7|NAGZ_SHESM Beta-hexosaminidase OS=Shewanella sp. (strain MR-4) GN=nagZ PE=3 SV=1 40 315 2.0E-24
sp|Q2P4L0|NAGZ_XANOM Beta-hexosaminidase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=nagZ PE=3 SV=1 31 330 2.0E-24
sp|Q8EEW2|NAGZ_SHEON Beta-hexosaminidase OS=Shewanella oneidensis (strain MR-1) GN=nagZ PE=3 SV=1 40 315 4.0E-24
sp|A7MFT1|NAGZ_CROS8 Beta-hexosaminidase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=nagZ PE=3 SV=1 37 347 4.0E-24
sp|P44955|NAGZ_HAEIN Beta-hexosaminidase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=nagZ PE=3 SV=1 54 330 6.0E-24
sp|Q8PMU1|NAGZ_XANAC Beta-hexosaminidase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=nagZ PE=3 SV=1 31 330 1.0E-23
sp|Q3BVU6|NAGZ_XANC5 Beta-hexosaminidase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=nagZ PE=3 SV=2 31 330 1.0E-23
sp|A5UDA9|NAGZ_HAEIE Beta-hexosaminidase OS=Haemophilus influenzae (strain PittEE) GN=nagZ PE=3 SV=1 54 331 1.0E-23
sp|Q0HVQ8|NAGZ_SHESR Beta-hexosaminidase OS=Shewanella sp. (strain MR-7) GN=nagZ PE=3 SV=1 40 315 1.0E-23
sp|B0BQ51|NAGZ_ACTPJ Beta-hexosaminidase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=nagZ PE=3 SV=1 31 348 2.0E-23
sp|Q8PB42|NAGZ_XANCP Beta-hexosaminidase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=nagZ PE=3 SV=1 31 330 2.0E-23
sp|B0RX17|NAGZ_XANCB Beta-hexosaminidase OS=Xanthomonas campestris pv. campestris (strain B100) GN=nagZ PE=3 SV=1 31 330 2.0E-23
sp|Q4USG7|NAGZ_XANC8 Beta-hexosaminidase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=nagZ PE=3 SV=1 31 330 2.0E-23
sp|B3GXZ7|NAGZ_ACTP7 Beta-hexosaminidase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=nagZ PE=3 SV=1 31 348 2.0E-23
sp|A3N1B7|NAGZ_ACTP2 Beta-hexosaminidase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=nagZ PE=3 SV=1 31 348 2.0E-23
sp|Q7NWB7|NAGZ_CHRVO Beta-hexosaminidase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=nagZ PE=3 SV=1 54 315 5.0E-23
sp|Q4QLU8|NAGZ_HAEI8 Beta-hexosaminidase OS=Haemophilus influenzae (strain 86-028NP) GN=nagZ PE=3 SV=1 54 330 7.0E-23
sp|Q7WUL3|NAG3_CELFI Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi GN=nag3 PE=1 SV=1 53 403 1.0E-22
sp|B1JI47|NAGZ_YERPY Beta-hexosaminidase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=nagZ PE=3 SV=1 40 315 3.0E-22
sp|A7FH41|NAGZ_YERP3 Beta-hexosaminidase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=nagZ PE=3 SV=1 40 315 3.0E-22
sp|Q8ZFS3|NAGZ_YERPE Beta-hexosaminidase OS=Yersinia pestis GN=nagZ PE=3 SV=1 40 315 5.0E-22
sp|Q669N5|NAGZ_YERPS Beta-hexosaminidase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=nagZ PE=3 SV=1 40 315 7.0E-22
sp|B2K731|NAGZ_YERPB Beta-hexosaminidase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=nagZ PE=3 SV=1 40 315 7.0E-22
sp|B4EVE7|NAGZ_PROMH Beta-hexosaminidase OS=Proteus mirabilis (strain HI4320) GN=nagZ PE=3 SV=1 37 315 8.0E-22
sp|B0UTC6|NAGZ_HISS2 Beta-hexosaminidase OS=Histophilus somni (strain 2336) GN=nagZ PE=3 SV=1 31 315 3.0E-21
sp|A6VKU4|NAGZ_ACTSZ Beta-hexosaminidase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=nagZ PE=3 SV=1 32 330 7.0E-21
sp|B5XXG4|NAGZ_KLEP3 Beta-hexosaminidase OS=Klebsiella pneumoniae (strain 342) GN=nagZ PE=3 SV=1 37 315 9.0E-21
sp|Q0I414|NAGZ_HAES1 Beta-hexosaminidase OS=Haemophilus somnus (strain 129Pt) GN=nagZ PE=3 SV=1 31 315 1.0E-20
sp|B2VDM3|NAGZ_ERWT9 Beta-hexosaminidase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=nagZ PE=3 SV=1 38 347 1.0E-20
sp|B7LT32|NAGZ_ESCF3 Beta-hexosaminidase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=nagZ PE=3 SV=1 37 315 1.0E-20
sp|Q3J953|NAGZ_NITOC Beta-hexosaminidase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=nagZ PE=3 SV=1 32 327 2.0E-20
sp|Q8ZQ06|NAGZ_SALTY Beta-hexosaminidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nagZ PE=1 SV=1 32 315 2.0E-20
sp|B4TTH9|NAGZ_SALSV Beta-hexosaminidase OS=Salmonella schwarzengrund (strain CVM19633) GN=nagZ PE=3 SV=1 32 315 2.0E-20
sp|A9N5J6|NAGZ_SALPB Beta-hexosaminidase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=nagZ PE=3 SV=1 32 315 2.0E-20
sp|B4T3P6|NAGZ_SALNS Beta-hexosaminidase OS=Salmonella newport (strain SL254) GN=nagZ PE=3 SV=1 32 315 2.0E-20
sp|B4TFI4|NAGZ_SALHS Beta-hexosaminidase OS=Salmonella heidelberg (strain SL476) GN=nagZ PE=3 SV=1 32 315 2.0E-20
sp|B5RB93|NAGZ_SALG2 Beta-hexosaminidase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=nagZ PE=3 SV=1 32 315 2.0E-20
sp|B5QXC7|NAGZ_SALEP Beta-hexosaminidase OS=Salmonella enteritidis PT4 (strain P125109) GN=nagZ PE=3 SV=1 32 315 2.0E-20
sp|B5FK98|NAGZ_SALDC Beta-hexosaminidase OS=Salmonella dublin (strain CT_02021853) GN=nagZ PE=3 SV=1 32 315 2.0E-20
sp|Q57QE6|NAGZ_SALCH Beta-hexosaminidase OS=Salmonella choleraesuis (strain SC-B67) GN=nagZ PE=3 SV=1 32 315 2.0E-20
sp|B5F8E5|NAGZ_SALA4 Beta-hexosaminidase OS=Salmonella agona (strain SL483) GN=nagZ PE=3 SV=1 32 315 2.0E-20
sp|C5BFM6|NAGZ_EDWI9 Beta-hexosaminidase OS=Edwardsiella ictaluri (strain 93-146) GN=nagZ PE=3 SV=1 38 315 2.0E-20
sp|P75949|NAGZ_ECOLI Beta-hexosaminidase OS=Escherichia coli (strain K12) GN=nagZ PE=1 SV=1 37 315 3.0E-20
sp|B1XA17|NAGZ_ECODH Beta-hexosaminidase OS=Escherichia coli (strain K12 / DH10B) GN=nagZ PE=3 SV=1 37 315 3.0E-20
sp|C4ZS47|NAGZ_ECOBW Beta-hexosaminidase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=nagZ PE=3 SV=1 37 315 3.0E-20
sp|Q8Z7I6|NAGZ_SALTI Beta-hexosaminidase OS=Salmonella typhi GN=nagZ PE=3 SV=1 32 315 3.0E-20
sp|Q5PGT0|NAGZ_SALPA Beta-hexosaminidase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=nagZ PE=3 SV=2 32 315 3.0E-20
sp|B6I9I5|NAGZ_ECOSE Beta-hexosaminidase OS=Escherichia coli (strain SE11) GN=nagZ PE=3 SV=1 38 315 4.0E-20
sp|B7LX41|NAGZ_ECO8A Beta-hexosaminidase OS=Escherichia coli O8 (strain IAI1) GN=nagZ PE=3 SV=1 38 315 4.0E-20
sp|B7LG40|NAGZ_ECO55 Beta-hexosaminidase OS=Escherichia coli (strain 55989 / EAEC) GN=nagZ PE=3 SV=1 38 315 4.0E-20
sp|A7ZKL1|NAGZ_ECO24 Beta-hexosaminidase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=nagZ PE=3 SV=1 38 315 5.0E-20
sp|Q9CPH0|NAGZ_PASMU Beta-hexosaminidase OS=Pasteurella multocida (strain Pm70) GN=nagZ PE=3 SV=1 32 330 5.0E-20
sp|A1JME4|NAGZ_YERE8 Beta-hexosaminidase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=nagZ PE=3 SV=1 40 315 5.0E-20
sp|B1IUF8|NAGZ_ECOLC Beta-hexosaminidase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=nagZ PE=3 SV=1 37 315 8.0E-20
sp|A7ZZ65|NAGZ_ECOHS Beta-hexosaminidase OS=Escherichia coli O9:H4 (strain HS) GN=nagZ PE=3 SV=1 37 315 8.0E-20
sp|Q7UCW4|NAGZ_SHIFL Beta-hexosaminidase OS=Shigella flexneri GN=nagZ PE=3 SV=2 37 315 1.0E-19
sp|Q1RD47|NAGZ_ECOUT Beta-hexosaminidase OS=Escherichia coli (strain UTI89 / UPEC) GN=nagZ PE=3 SV=1 37 315 1.0E-19
sp|B7MJ94|NAGZ_ECO45 Beta-hexosaminidase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=nagZ PE=3 SV=1 37 315 1.0E-19
sp|Q5P081|NAGZ_AROAE Beta-hexosaminidase OS=Aromatoleum aromaticum (strain EbN1) GN=nagZ PE=3 SV=1 38 323 1.0E-19
sp|B7MTN7|NAGZ_ECO81 Beta-hexosaminidase OS=Escherichia coli O81 (strain ED1a) GN=nagZ PE=3 SV=1 37 315 1.0E-19
sp|B7UPC3|NAGZ_ECO27 Beta-hexosaminidase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=nagZ PE=3 SV=1 37 315 1.0E-19
sp|B5YVX6|NAGZ_ECO5E Beta-hexosaminidase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=nagZ PE=3 SV=1 37 315 1.0E-19
sp|P58067|NAGZ_ECO57 Beta-hexosaminidase OS=Escherichia coli O157:H7 GN=nagZ PE=3 SV=1 37 315 1.0E-19
sp|B8GSD2|NAGZ_THISH Beta-hexosaminidase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=nagZ PE=3 SV=1 32 315 2.0E-19
sp|Q65VK7|NAGZ_MANSM Beta-hexosaminidase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=nagZ PE=3 SV=1 54 361 2.0E-19
sp|Q6D674|NAGZ_PECAS Beta-hexosaminidase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=nagZ PE=3 SV=1 40 315 2.0E-19
sp|Q8FIN2|NAGZ_ECOL6 Beta-hexosaminidase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nagZ PE=3 SV=1 37 315 2.0E-19
sp|B1LI37|NAGZ_ECOSM Beta-hexosaminidase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=nagZ PE=3 SV=1 37 315 3.0E-19
sp|B7NAY5|NAGZ_ECOLU Beta-hexosaminidase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=nagZ PE=3 SV=1 37 315 3.0E-19
sp|B7NKH2|NAGZ_ECO7I Beta-hexosaminidase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=nagZ PE=3 SV=1 37 315 3.0E-19
sp|Q32EW7|NAGZ_SHIDS Beta-hexosaminidase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=nagZ PE=3 SV=1 37 315 3.0E-19
sp|A1AA01|NAGZ_ECOK1 Beta-hexosaminidase OS=Escherichia coli O1:K1 / APEC GN=nagZ PE=3 SV=1 37 315 4.0E-19
sp|Q3Z310|NAGZ_SHISS Beta-hexosaminidase OS=Shigella sonnei (strain Ss046) GN=nagZ PE=3 SV=1 37 315 1.0E-18
sp|C6DKR8|NAGZ_PECCP Beta-hexosaminidase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=nagZ PE=3 SV=1 40 315 2.0E-18
sp|Q31ZG4|NAGZ_SHIBS Beta-hexosaminidase OS=Shigella boydii serotype 4 (strain Sb227) GN=nagZ PE=3 SV=1 37 315 3.0E-18
sp|B2U513|NAGZ_SHIB3 Beta-hexosaminidase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=nagZ PE=3 SV=1 37 315 3.0E-18
sp|Q7VNI8|NAGZ_HAEDU Beta-hexosaminidase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=nagZ PE=3 SV=1 31 358 9.0E-18
sp|Q606N2|NAGZ_METCA Beta-hexosaminidase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=nagZ PE=3 SV=1 55 329 9.0E-18
sp|B0XPB8|BGLM_ASPFC Probable beta-glucosidase M OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglM PE=3 SV=1 102 313 2.0E-13
sp|Q0CTD7|BGLA_ASPTN Probable beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglA PE=3 SV=1 108 400 2.0E-13
sp|Q2UUD6|BGLA_ASPOR Probable beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglA PE=3 SV=1 108 400 2.0E-13
sp|D4AN50|BGLA_ARTBC Probable beta-glucosidase ARB_05654 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05654 PE=1 SV=1 108 405 2.0E-13
sp|A5ABF5|BGLM_ASPNC Probable beta-glucosidase M OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglM PE=3 SV=1 102 313 3.0E-13
sp|D0VKF5|BGLA_ASPTE Probable beta-glucosidase A OS=Aspergillus terreus GN=bglA PE=2 SV=1 108 400 3.0E-13
sp|B8NRX2|BGLA_ASPFN Probable beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglA PE=3 SV=1 108 400 4.0E-13
sp|Q4WR62|BGLM_ASPFU Probable beta-glucosidase M OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglM PE=3 SV=1 102 313 6.0E-13
sp|P87076|BGLA_ASPKW Beta-glucosidase A OS=Aspergillus kawachii (strain NBRC 4308) GN=bglA PE=1 SV=2 106 313 9.0E-13
sp|Q5BCC6|BGLC_EMENI Beta-glucosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglC PE=1 SV=1 46 403 2.0E-12
sp|Q56078|BGLX_SALTY Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=bglX PE=3 SV=2 24 405 2.0E-12
sp|D4AQ52|HEXA_ARTBC Uncharacterized secreted glycosyl hydrolase ARB_06359 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_06359 PE=1 SV=1 29 358 2.0E-12
sp|Q23892|GLUA_DICDI Lysosomal beta glucosidase OS=Dictyostelium discoideum GN=gluA PE=1 SV=2 73 403 2.0E-12
sp|Q0C7L4|BGLM_ASPTN Probable beta-glucosidase M OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglM PE=3 SV=1 102 313 2.0E-12
sp|A1D122|BGLM_NEOFI Probable beta-glucosidase M OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglM PE=3 SV=1 102 313 3.0E-12
sp|Q5B5S8|BGLA_EMENI Probable beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglA PE=3 SV=2 108 404 4.0E-12
sp|P48825|BGL1_ASPAC Beta-glucosidase 1 OS=Aspergillus aculeatus PE=1 SV=1 106 313 4.0E-12
sp|A1CR85|BGLA_ASPCL Probable beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglA PE=3 SV=1 108 405 5.0E-12
sp|A2RAL4|BGLA_ASPNC Probable beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglA PE=3 SV=1 80 313 1.0E-11
sp|B8NGU6|BGLC_ASPFN Probable beta-glucosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglC PE=3 SV=1 47 402 1.0E-11
sp|Q5B9F2|BGLL_EMENI Probable beta-glucosidase L OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglL PE=3 SV=1 110 403 2.0E-11
sp|Q2UFP8|BGLC_ASPOR Probable beta-glucosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglC PE=3 SV=2 47 402 3.0E-11
sp|Q2UDK7|BGLM_ASPOR Probable beta-glucosidase M OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglM PE=3 SV=1 102 402 4.0E-11
sp|B0XPE1|BGLA_ASPFC Probable beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglA PE=3 SV=1 108 404 4.0E-11
sp|Q4WJJ3|BGLA_ASPFU Probable beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglA PE=3 SV=1 108 404 4.0E-11
sp|B8N5S6|BGLM_ASPFN Probable beta-glucosidase M OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglM PE=3 SV=1 102 402 5.0E-11
sp|G4N7Z0|CEL3B_MAGO7 Beta-glucosidase cel3A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel3B PE=1 SV=1 102 350 5.0E-11
sp|Q2U325|BGLG_ASPOR Probable beta-glucosidase G OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglG PE=3 SV=1 108 311 6.0E-11
sp|B8NMR5|BGLG_ASPFN Probable beta-glucosidase G OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglG PE=3 SV=1 108 311 6.0E-11
sp|P22506|BGL1_SACFI Beta-glucosidase 1 OS=Saccharomycopsis fibuligera GN=BGL1 PE=3 SV=1 108 318 1.0E-10
sp|A1CA51|BGLI_ASPCL Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglI PE=3 SV=1 89 466 1.0E-10
sp|A1D451|BGLA_NEOFI Probable beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglA PE=3 SV=1 108 404 1.0E-10
sp|Q5AWD4|BGLM_EMENI Probable beta-glucosidase M OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglM PE=3 SV=1 102 313 7.0E-10
sp|Q5B0F4|BGLG_EMENI Probable beta-glucosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglG PE=3 SV=2 108 311 7.0E-10
sp|P33363|BGLX_ECOLI Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) GN=bglX PE=1 SV=2 24 405 8.0E-10
sp|P14002|BGLB_CLOTH Thermostable beta-glucosidase B OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=bglB PE=1 SV=2 113 405 1.0E-09
sp|P22507|BGL2_SACFI Beta-glucosidase 2 OS=Saccharomycopsis fibuligera GN=BGL2 PE=3 SV=1 108 284 2.0E-09
sp|Q2U8Y5|BGLI_ASPOR Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglI PE=3 SV=1 113 402 2.0E-09
sp|B8NDE2|BGLI_ASPFN Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglI PE=3 SV=2 113 402 2.0E-09
sp|A1DCV5|BGLL_NEOFI Probable beta-glucosidase L OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglL PE=3 SV=1 110 402 6.0E-09
sp|A1DC16|BGLG_NEOFI Probable beta-glucosidase G OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglG PE=3 SV=1 108 311 6.0E-09
sp|Q4WU49|BGLI_ASPFU Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglI PE=3 SV=1 113 402 8.0E-09
sp|Q0CUC1|BGLG_ASPTN Probable beta-glucosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglG PE=3 SV=1 108 350 1.0E-08
sp|B0Y3M6|BGLI_ASPFC Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglI PE=3 SV=1 113 402 2.0E-08
sp|A1DFA8|BGLI_NEOFI Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglI PE=3 SV=1 113 402 2.0E-08
sp|A7LXU3|BGH3B_BACO1 Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02659 PE=1 SV=1 45 353 2.0E-08
sp|B0YB65|BGLL_ASPFC Probable beta-glucosidase L OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglL PE=3 SV=1 110 402 3.0E-08
sp|Q4WGT3|BGLL_ASPFU Probable beta-glucosidase L OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglL PE=3 SV=1 110 402 3.0E-08
sp|A1DMR8|BGLF_NEOFI Probable beta-glucosidase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglF PE=3 SV=1 106 318 3.0E-08
sp|Q0CEF3|BGLL_ASPTN Probable beta-glucosidase L OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglL PE=3 SV=1 110 402 3.0E-08
sp|B0Y7Q8|BGLF_ASPFC Probable beta-glucosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglF PE=3 SV=2 106 318 4.0E-08
sp|Q4WMU3|BGLF_ASPFU Probable beta-glucosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglF PE=3 SV=2 106 318 5.0E-08
sp|Q9P6J6|BGLS_SCHPO Putative beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.04 PE=3 SV=1 103 311 6.0E-08
sp|Q5B6C6|BGLF_EMENI Probable beta-glucosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglF PE=3 SV=2 106 350 7.0E-08
sp|Q5BB53|BGLI_EMENI Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglI PE=2 SV=2 113 403 9.0E-08
sp|Q5AYH8|BGLE_EMENI Probable beta-glucosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglE PE=3 SV=1 108 286 1.0E-07
sp|P06835|BGLS_WICAO Beta-glucosidase OS=Wickerhamomyces anomalus PE=3 SV=1 113 350 1.0E-07
sp|A2R989|BGLI_ASPNC Probable beta-glucosidase I OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglI PE=3 SV=1 113 402 2.0E-07
sp|G4NI45|CEL3A_MAGO7 Beta-glucosidase cel3A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel3A PE=1 SV=1 110 402 2.0E-07
sp|A1DLJ5|BGLE_NEOFI Probable beta-glucosidase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglE PE=3 SV=1 108 286 2.0E-07
sp|Q4WD56|BGLE_ASPFU Probable beta-glucosidase E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglE PE=3 SV=1 100 286 3.0E-07
sp|B0YD91|BGLE_ASPFC Probable beta-glucosidase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglE PE=3 SV=1 100 286 3.0E-07
sp|Q2UN12|BGLF_ASPOR Probable beta-glucosidase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglF PE=3 SV=1 106 402 5.0E-07
sp|B8NP65|BGLF_ASPFN Probable beta-glucosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglF PE=3 SV=1 106 318 6.0E-07
sp|Q2UTX5|BGLE_ASPOR Probable beta-glucosidase E OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglE PE=3 SV=2 108 286 6.0E-07
sp|Q2UNR0|BGLD_ASPOR Probable beta-glucosidase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglD PE=3 SV=1 45 280 7.0E-07
sp|B8NJF4|BGLD_ASPFN Probable beta-glucosidase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglD PE=3 SV=2 85 280 8.0E-07
sp|Q0CI67|BGLF_ASPTN Probable beta-glucosidase F OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglF PE=3 SV=1 106 286 2.0E-06
sp|E7CY69|APY_BIFLN Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum GN=apy PE=1 SV=1 113 403 4.0E-06
sp|A1CMH6|BGLE_ASPCL Probable beta-glucosidase E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglE PE=3 SV=1 100 286 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

Domain # Start End Length
1 667 689 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8771
MAATTTSSSSKTDDSDLDPLWQNLDWAIGHILIMGWDGTEVTPQIKSLIEDHHLGSIILTAKNLKSAQQTARLVQ
ELQTIAQNAGHPQPLLIALDQENGGVNSLFDEDYVCQFPSAMGVAATGRAELAYEVTKATATEISACGVNLMLGP
VLDVLNNARYQPLGVRATGDDPQEVSLYGLAALKGIRDAGMASCGKHFPSYGNLDFLGSNLDVPIITQTLEELSL
SALVPFRNAIASGSLDAMFVGGCGISNPSMNVSHACLSDQVVDDLLRNELGFKGVAISECLEMEALSHDLGVQNG
VVMAVEAGCDLVLLCRAYDVQLEAIKGLKLGYENGIITKERIYTSLRRVLKLKSTCTSWSKALSPPATSLLSQLH
PAHLSLSRRAYDESITVVRDKEKLLPLSGSMHAGEELLLLTPLVKPLPASSMTKSLLEAKNNNYSDAPTNHDVWA
HQARERGAIMSGEGVFREFGKNLARYRNEKLLHTSYTANGVRPVHENLINRASCIIIVTADANRNLYQAGFTKHV
DMMCSMHRSRGNKKQLIVVAVSSPYDFAMDKSIGTYICTYDFTENAMSALVRVLVGEIDPPVGSMPGTLRKSKKV
LKSRQLWLVEEYDRSRDAKGLNELLRAVHRATAPDLEFLKSTSAASFELNVSTIKEAHFVVRNSSTQALYGFVAT
YYIGVVGILGAIFVDPGKRNVSIGRSLHRRALKSLSQQRGLKKIQLGTTFPSVFLGIPSNLELSTVKDWFCNSGW
DTQFPRRLTNMVIRDLGNWLVPEGLLQSIQRTNISFDLIHGLDNADSVLHHVHANANPEVLELYKHALAENKSCG
IVRAKDPAGNLIGSVIICRQNSALVTHVPSLLSQTGDVAGIIAPTVPPTPQSILVLQGLALMGVRQCKSHKAAKA
LLTWVVDDASEPLLAMGFEILQVFEEITSSPEICQT*
Coding >Hirsu2|8771
ATGGCCGCCACCACCACCAGCTCCAGCTCCAAGACAGACGACTCCGACTTGGACCCACTATGGCAGAACCTCGAC
TGGGCCATCGGCCACATCCTCATCATGGGATGGGATGGAACCGAGGTCACCCCCCAGATCAAGAGCCTCATTGAG
GATCACCATCTCGGATCCATCATTCTGACGGCCAAGAACCTCAAATCGGCCCAACAAACTGCCAGACTGGTCCAA
GAACTCCAGACGATTGCTCAAAACGCCGGCCATCCTCAGCCACTGCTCATCGCTCTGGATCAGGAGAATGGAGGG
GTCAACAGTCTCTTCGACGAGGACTATGTCTGCCAGTTCCCGAGTGCCATGGGTGTTGCCGCCACGGGCCGGGCC
GAGCTGGCCTATGAGGTGACCAAGGCCACCGCTACCGAGATTTCGGCGTGTGGGGTCAACTTGATGCTCGGCCCC
GTCCTCGACGTCCTCAACAATGCCCGCTATCAGCCGCTCGGCGTCCGTGCCACGGGCGACGATCCCCAGGAGGTC
TCTCTTTACGGCTTGGCCGCGCTCAAGGGCATCCGTGATGCTGGAATGGCCTCGTGCGGCAAGCACTTCCCCTCG
TATGGAAACCTCGATTTCCTCGGTTCCAACCTCGATGTGCCCATCATCACTCAGACCCTGGAGGAGCTGAGCCTG
AGCGCGCTTGTGCCCTTCCGGAATGCCATTGCATCCGGGAGCCTGGACGCCATGTTTGTCGGCGGTTGTGGCATC
TCCAATCCCTCCATGAATGTCAGCCACGCCTGCCTCTCCGATCAAGTCGTCGATGACCTGCTCCGTAACGAGCTC
GGCTTCAAGGGCGTTGCCATCTCCGAGTGCCTGGAGATGGAGGCCCTGAGCCACGACCTTGGCGTTCAGAACGGC
GTCGTCATGGCCGTCGAGGCTGGCTGTGACCTCGTTCTCCTCTGCCGTGCCTACGACGTCCAGCTCGAGGCCATC
AAGGGTCTCAAGCTGGGATACGAAAACGGCATCATCACCAAGGAGAGGATTTACACCTCGCTCCGGCGCGTCCTC
AAGCTCAAGTCGACTTGCACCTCGTGGTCGAAAGCTCTCAGTCCGCCCGCCACCTCCCTGCTCTCCCAGCTACAT
CCCGCCCATCTATCGCTGTCCCGCAGGGCCTACGACGAGTCTATCACGGTCGTGAGGGACAAGGAGAAGCTTCTG
CCCCTCTCGGGATCCATGCATGCCGGCGAGGAGCTTCTCTTGCTCACTCCGCTGGTCAAGCCCCTTCCGGCGTCG
TCCATGACGAAAAGCCTGCTCGAGGCAAAGAACAACAACTACTCGGATGCCCCCACGAACCATGATGTCTGGGCG
CACCAGGCTCGCGAACGAGGCGCCATCATGAGCGGCGAGGGAGTCTTCCGGGAGTTTGGCAAGAATCTTGCGCGA
TACCGTAACGAGAAGCTCCTTCACACGAGCTATACAGCCAACGGGGTCCGGCCAGTTCACGAGAATCTCATCAAC
AGAGCATCGTGCATCATCATCGTCACCGCCGACGCCAACCGGAACCTCTACCAGGCCGGCTTTACCAAGCACGTC
GACATGATGTGCTCCATGCACCGCAGCAGGGGAAACAAAAAGCAGCTGATTGTCGTCGCCGTCAGCTCTCCGTAC
GACTTTGCCATGGACAAGTCCATCGGCACCTACATCTGTACCTACGACTTCACGGAGAACGCAATGTCTGCGCTG
GTGCGTGTGCTCGTTGGCGAGATTGACCCTCCCGTCGGAAGCATGCCCGGGACCCTGCGCAAGAGTAAGAAGGTG
CTCAAGTCTCGGCAGCTCTGGCTTGTGGAAGAATACGACCGGTCTCGGGACGCCAAGGGCCTGAACGAGCTGCTG
CGTGCCGTCCACCGAGCAACTGCACCCGATCTCGAGTTCCTCAAATCAACGAGCGCCGCCTCCTTCGAACTCAAT
GTGTCGACCATCAAGGAGGCTCACTTCGTGGTCCGGAACAGCAGCACGCAGGCGCTGTACGGGTTTGTCGCGACA
TACTACATCGGCGTGGTCGGCATCTTGGGAGCCATTTTCGTCGATCCTGGGAAGCGGAACGTGTCGATCGGCCGG
TCTCTGCACCGACGAGCCCTCAAGAGCCTTTCCCAGCAGCGGGGGTTGAAGAAGATCCAGCTGGGAACGACTTTC
CCGAGCGTCTTCCTCGGCATTCCCTCGAACCTCGAGCTGAGCACGGTCAAGGACTGGTTCTGCAACAGCGGCTGG
GACACGCAATTCCCGAGGAGGCTGACCAATATGGTCATCCGGGATCTCGGCAACTGGCTCGTGCCGGAGGGGCTT
CTGCAGAGCATCCAGAGGACAAACATCAGCTTCGACTTGATCCACGGCCTCGACAACGCCGACAGCGTCCTCCAT
CACGTGCACGCAAACGCCAATCCCGAAGTCCTGGAACTGTATAAGCACGCACTCGCCGAAAATAAATCATGCGGC
ATCGTGCGCGCCAAAGACCCGGCGGGAAACCTGATTGGATCCGTCATCATCTGCCGACAGAACAGTGCCCTCGTC
ACGCATGTCCCATCGTTGCTATCGCAGACGGGCGACGTGGCTGGCATCATTGCGCCTACCGTGCCACCAACGCCC
CAGTCGATCCTCGTCCTGCAGGGGCTGGCGCTGATGGGAGTCCGCCAGTGCAAAAGCCACAAGGCTGCCAAAGCG
CTCCTCACCTGGGTCGTGGACGATGCGAGCGAGCCGCTTCTGGCGATGGGGTTCGAGATTCTCCAGGTATTCGAG
GAGATTACGAGCTCTCCTGAGATTTGTCAGACGTGA
Transcript >Hirsu2|8771
ATGGCCGCCACCACCACCAGCTCCAGCTCCAAGACAGACGACTCCGACTTGGACCCACTATGGCAGAACCTCGAC
TGGGCCATCGGCCACATCCTCATCATGGGATGGGATGGAACCGAGGTCACCCCCCAGATCAAGAGCCTCATTGAG
GATCACCATCTCGGATCCATCATTCTGACGGCCAAGAACCTCAAATCGGCCCAACAAACTGCCAGACTGGTCCAA
GAACTCCAGACGATTGCTCAAAACGCCGGCCATCCTCAGCCACTGCTCATCGCTCTGGATCAGGAGAATGGAGGG
GTCAACAGTCTCTTCGACGAGGACTATGTCTGCCAGTTCCCGAGTGCCATGGGTGTTGCCGCCACGGGCCGGGCC
GAGCTGGCCTATGAGGTGACCAAGGCCACCGCTACCGAGATTTCGGCGTGTGGGGTCAACTTGATGCTCGGCCCC
GTCCTCGACGTCCTCAACAATGCCCGCTATCAGCCGCTCGGCGTCCGTGCCACGGGCGACGATCCCCAGGAGGTC
TCTCTTTACGGCTTGGCCGCGCTCAAGGGCATCCGTGATGCTGGAATGGCCTCGTGCGGCAAGCACTTCCCCTCG
TATGGAAACCTCGATTTCCTCGGTTCCAACCTCGATGTGCCCATCATCACTCAGACCCTGGAGGAGCTGAGCCTG
AGCGCGCTTGTGCCCTTCCGGAATGCCATTGCATCCGGGAGCCTGGACGCCATGTTTGTCGGCGGTTGTGGCATC
TCCAATCCCTCCATGAATGTCAGCCACGCCTGCCTCTCCGATCAAGTCGTCGATGACCTGCTCCGTAACGAGCTC
GGCTTCAAGGGCGTTGCCATCTCCGAGTGCCTGGAGATGGAGGCCCTGAGCCACGACCTTGGCGTTCAGAACGGC
GTCGTCATGGCCGTCGAGGCTGGCTGTGACCTCGTTCTCCTCTGCCGTGCCTACGACGTCCAGCTCGAGGCCATC
AAGGGTCTCAAGCTGGGATACGAAAACGGCATCATCACCAAGGAGAGGATTTACACCTCGCTCCGGCGCGTCCTC
AAGCTCAAGTCGACTTGCACCTCGTGGTCGAAAGCTCTCAGTCCGCCCGCCACCTCCCTGCTCTCCCAGCTACAT
CCCGCCCATCTATCGCTGTCCCGCAGGGCCTACGACGAGTCTATCACGGTCGTGAGGGACAAGGAGAAGCTTCTG
CCCCTCTCGGGATCCATGCATGCCGGCGAGGAGCTTCTCTTGCTCACTCCGCTGGTCAAGCCCCTTCCGGCGTCG
TCCATGACGAAAAGCCTGCTCGAGGCAAAGAACAACAACTACTCGGATGCCCCCACGAACCATGATGTCTGGGCG
CACCAGGCTCGCGAACGAGGCGCCATCATGAGCGGCGAGGGAGTCTTCCGGGAGTTTGGCAAGAATCTTGCGCGA
TACCGTAACGAGAAGCTCCTTCACACGAGCTATACAGCCAACGGGGTCCGGCCAGTTCACGAGAATCTCATCAAC
AGAGCATCGTGCATCATCATCGTCACCGCCGACGCCAACCGGAACCTCTACCAGGCCGGCTTTACCAAGCACGTC
GACATGATGTGCTCCATGCACCGCAGCAGGGGAAACAAAAAGCAGCTGATTGTCGTCGCCGTCAGCTCTCCGTAC
GACTTTGCCATGGACAAGTCCATCGGCACCTACATCTGTACCTACGACTTCACGGAGAACGCAATGTCTGCGCTG
GTGCGTGTGCTCGTTGGCGAGATTGACCCTCCCGTCGGAAGCATGCCCGGGACCCTGCGCAAGAGTAAGAAGGTG
CTCAAGTCTCGGCAGCTCTGGCTTGTGGAAGAATACGACCGGTCTCGGGACGCCAAGGGCCTGAACGAGCTGCTG
CGTGCCGTCCACCGAGCAACTGCACCCGATCTCGAGTTCCTCAAATCAACGAGCGCCGCCTCCTTCGAACTCAAT
GTGTCGACCATCAAGGAGGCTCACTTCGTGGTCCGGAACAGCAGCACGCAGGCGCTGTACGGGTTTGTCGCGACA
TACTACATCGGCGTGGTCGGCATCTTGGGAGCCATTTTCGTCGATCCTGGGAAGCGGAACGTGTCGATCGGCCGG
TCTCTGCACCGACGAGCCCTCAAGAGCCTTTCCCAGCAGCGGGGGTTGAAGAAGATCCAGCTGGGAACGACTTTC
CCGAGCGTCTTCCTCGGCATTCCCTCGAACCTCGAGCTGAGCACGGTCAAGGACTGGTTCTGCAACAGCGGCTGG
GACACGCAATTCCCGAGGAGGCTGACCAATATGGTCATCCGGGATCTCGGCAACTGGCTCGTGCCGGAGGGGCTT
CTGCAGAGCATCCAGAGGACAAACATCAGCTTCGACTTGATCCACGGCCTCGACAACGCCGACAGCGTCCTCCAT
CACGTGCACGCAAACGCCAATCCCGAAGTCCTGGAACTGTATAAGCACGCACTCGCCGAAAATAAATCATGCGGC
ATCGTGCGCGCCAAAGACCCGGCGGGAAACCTGATTGGATCCGTCATCATCTGCCGACAGAACAGTGCCCTCGTC
ACGCATGTCCCATCGTTGCTATCGCAGACGGGCGACGTGGCTGGCATCATTGCGCCTACCGTGCCACCAACGCCC
CAGTCGATCCTCGTCCTGCAGGGGCTGGCGCTGATGGGAGTCCGCCAGTGCAAAAGCCACAAGGCTGCCAAAGCG
CTCCTCACCTGGGTCGTGGACGATGCGAGCGAGCCGCTTCTGGCGATGGGGTTCGAGATTCTCCAGGTATTCGAG
GAGATTACGAGCTCTCCTGAGATTTGTCAGACGTGA
Gene >Hirsu2|8771
ATGGCCGCCACCACCACCAGCTCCAGCTCCAAGACAGACGACTCCGACTTGGACCCACTATGGCAGAACCTCGAC
TGGTAAGCGCCTGCGCCTCGACTCGCCTCGTCCTTCGGCAGCTTCCGAGGCCGGAGGGGCTGACAGGTCTCCTGC
AGGGCCATCGGCCACATCCTCATCATGGGATGGGATGGAACCGAGGTCACCCCCCAGATCAAGAGCCTCATTGAG
GATCACCATCTCGGATCCATCATTCTGACGGCCAAGAACCTCAAATGTCTGTGCCTCCTTCCCTCCCTCGCCCGG
TCACTCGGTTCGAATACACCACTTTCCTCCTCCCTCCCGTCCCTCAGCTCTCTCCTGTTGAGCCGTCCTGGTCAC
ACGAGGGGAGGCGAGCCCCGATACTAATGTCCCTCGGGTAGCGGCCCAACAAACTGCCAGACTGGTCCAAGAACT
CCAGACGATTGCTCAAAACGCCGGCCATCCTCAGCCACTGCTCATCGCTCTGGATCAGGAGAATGGAGGGGTCAA
CAGTCTCTTCGACGAGGACTATGTCTGCCAGTTCCCGAGTGCCATGGGTGTTGCCGCCACGGGCCGGGCCGAGCT
GGCCTATGAGGTGACCAAGGCCACCGCTACCGAGATTTCGGCGTGTGGGGTCAACTTGATGCTCGGCCCCGTCCT
CGACGTCCTCAACAATGCCCGCTATCAGCCGCTCGGCGTCCGTGCCACGGGCGACGATCCCCAGGAGGTCTCTCT
TTACGGCTTGGCCGCGCTCAAGGGCATCCGTGATGCTGGAATGGCCTCGTGCGGCAAGCACTTCCCCTCGTATGG
AAACCTCGATTTCCTCGGTTCCAACCTCGATGTGCCCATCATCACTCAGACCCTGGAGGAGCTGAGCCTGAGCGC
GCTTGTGCCCTTCCGGAATGCCATTGCATCCGGGAGCCTGGACGCCATGTTTGTCGGCGGTTGTGGCATCTCCAA
TCCCTCCATGAATGTCAGCCACGCCTGCCTCTCCGATCAAGTCGTCGATGACCTGCTCCGTAACGAGCTCGGCTT
CAAGGGCGTTGCCATCTCCGAGTGCCTGGAGATGGAGGCCCTGAGCCACGACCTTGGCGTTCAGAACGGCGTCGT
CATGGCCGTCGAGGCTGGCTGTGACCTCGTTCTCCTCTGCCGTGCCTACGACGTCCAGCTCGAGGCCATCAAGGG
TCTCAAGCTGGGATACGAAAACGGCATCATCACCAAGGAGAGGATTTACACCTCGCTCCGGCGCGTCCTCAAGCT
CAAGTCGACTTGCACCTCGTGGTCGAAAGCTCTCAGTCCGCCCGCCACCTCCCTGCTCTCCCAGCTACATCCCGC
CCATCTATCGCTGTCCCGCAGGGCCTACGACGAGTCTATCACGGTCGTGAGGGACAAGGAGAAGCTTCTGCCCCT
CTCGGGATCCATGCATGCCGGCGAGGAGCTTCTCTTGCTCACTCCGCTGGTCAAGCCCCTTCCGGCGTCGTCCAT
GACGAAAAGCCTGCTCGAGGCAAAGAACAACAACTACTCGGATGCCCCCACGAACCATGATGTCTGGGCGCACCA
GGCTCGCGAACGAGGCGCCATCATGAGCGGCGAGGGAGTCTTCCGGGAGTTTGGCAAGAATCTTGCGCGATACCG
TAACGAGAAGCTCCTTCACACGAGCTATACAGCCAACGGGGTCCGGCCAGGTAAGAGGAGCACGCCACTGCCGCA
GCCGAAAGCCGTCGCTGACTCGTGGTGCCCTAGTTCACGAGAATCTCATCAACAGAGCATCGTGCATCATCATCG
TCACCGCCGACGCCAACCGGAACCTCTACCAGGCCGGCTTTACCAAGCACGTCGACATGATGTGCTCCATGCACC
GCAGCAGGGGAAACAAAAAGCAGCTGATTGTCGTCGCCGTCAGCTCTCCGTACGACTTTGCCATGGACAAGTCCA
TCGGCACCTACATCTGTACCTACGACTTCACGGAGAACGCAATGTCTGCGCTGGTGCGTGTGCTCGTTGGCGAGA
TTGACCCTCCCGTCGGAAGCATGCCCGGGACCCTGCGCAAGAGTAAGAAGGTGCTCAAGTCTCGGCAGCTCTGGC
TTGTGGAAGAATACGACCGGTCTCGGGACGCCAAGGGCCTGAACGAGCTGCTGCGTGCCGTCCACCGAGCAACTG
CACCCGATCTCGAGTTCCTCAAATCAACGAGCGCCGCCTCCTTCGAACTCAATGTGTCGACCATCAAGGAGGCTC
ACTTCGTGGTCCGGAACAGCAGCACGCAGGCGCTGTACGGGTTTGTCGCGACATACTACATCGGCGTGGTCGGCA
TCTTGGGAGCCATTTTCGTCGATCCTGGGAAGCGGAACGTGTCGATCGGCCGGTCTCTGCACCGACGAGCCCTCA
AGAGCCTTTCCCAGCAGCGGGGGTTGAAGAAGATCCAGCTGGGAACGACTTTCCCGAGCGTCTTCCTCGGCATTC
CCTCGAACCTCGAGCTGAGCACGGTCAAGGACTGGTTCTGCAACAGCGGCTGGGACACGCAATTCCCGAGGAGGC
TGACCAATATGGTCATCCGGGATCTCGGCAACTGGCTCGTGCCGGAGGGGCTTCTGCAGAGCATCCAGAGGACAA
ACATCAGCTTCGACTTGATCCACGGCCTCGACAACGCCGACAGCGTCCTCCATCACGTGCACGCAAACGCCAATC
CCGAAGTCCTGGAACTGTATAAGCACGCACTCGCCGAAAATAAATCATGCGGCATCGTGCGCGCCAAAGACCCGG
CGGGAAACCTGATTGGATCCGTCATCATCTGCCGACAGAACAGTGCCCTCGTCACGCATGTCCCATCGTTGCTAT
CGCAGACGGGCGACGTGGCTGGCATCATTGCGCCTACCGTGCCACCAACGCCCCAGTCGATCCTCGTCCTGCAGG
GGCTGGCGCTGATGGGAGTCCGCCAGTGCAAAAGCCACAAGGCTGCCAAAGCGCTCCTCACCTGGGTAAGACAGC
GCAGCTCTCCGTTCGAGACGCAGGGACCAAGTACTAACTGACTATGCCAGGTCGTGGACGATGCGAGCGAGCCGC
TTCTGGCGATGGGGTTCGAGATTCTCCAGGTATTCGAGGAGATTACGAGCTCTCCTGAGATGTGAGTGCCGCCGC
TACCCTCAGTCCGGCGTTCCGTGCAGAAGAGGCCTTGACTTGCAAACACAGTTGTCAGACGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail