Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8765
Gene name
LocationContig_595:2975..4175
Strand-
Gene length (bp)1200
Transcript length (bp)996
Coding sequence length (bp)996
Protein length (aa) 332

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00179 UQ_con Ubiquitin-conjugating enzyme 1.4E-09 25 96

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q17PP1|AKTIP_AEDAE Protein crossbronx homolog OS=Aedes aegypti GN=AAEL000265 PE=3 SV=1 19 97 4.0E-12
sp|B0X6E8|AKTIP_CULQU Protein crossbronx homolog OS=Culex quinquefasciatus GN=CPIJ015056 PE=3 SV=1 19 97 4.0E-11
sp|Q7PRH1|AKTIP_ANOGA Protein crossbronx homolog OS=Anopheles gambiae GN=AGAP010478 PE=3 SV=3 19 97 5.0E-11
sp|B4JWF5|AKTP2_DROGR Protein crossbronx-like OS=Drosophila grimshawi GN=GH22748 PE=3 SV=1 6 99 2.0E-08
sp|B4LPP8|AKTP2_DROVI Protein crossbronx-like OS=Drosophila virilis GN=GJ21397 PE=3 SV=1 24 99 7.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q17PP1|AKTIP_AEDAE Protein crossbronx homolog OS=Aedes aegypti GN=AAEL000265 PE=3 SV=1 19 97 4.0E-12
sp|B0X6E8|AKTIP_CULQU Protein crossbronx homolog OS=Culex quinquefasciatus GN=CPIJ015056 PE=3 SV=1 19 97 4.0E-11
sp|Q7PRH1|AKTIP_ANOGA Protein crossbronx homolog OS=Anopheles gambiae GN=AGAP010478 PE=3 SV=3 19 97 5.0E-11
sp|B4JWF5|AKTP2_DROGR Protein crossbronx-like OS=Drosophila grimshawi GN=GH22748 PE=3 SV=1 6 99 2.0E-08
sp|B4LPP8|AKTP2_DROVI Protein crossbronx-like OS=Drosophila virilis GN=GJ21397 PE=3 SV=1 24 99 7.0E-08
sp|P23566|UBC2_SCHPO Ubiquitin-conjugating enzyme E2 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp6 PE=1 SV=3 16 95 8.0E-08
sp|O74201|UBC2_CANAL Ubiquitin-conjugating enzyme E2 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UBC2 PE=2 SV=1 21 95 9.0E-08
sp|Q6CUD9|UBC2_KLULA Ubiquitin-conjugating enzyme E2 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=UBC2 PE=3 SV=1 21 95 1.0E-07
sp|P06104|UBC2_YEAST Ubiquitin-conjugating enzyme E2 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD6 PE=1 SV=1 16 95 1.0E-07
sp|B4KMF8|AKTP1_DROMO Protein crossbronx OS=Drosophila mojavensis GN=cbx PE=3 SV=1 20 102 1.0E-07
sp|B4MRW2|AKTP2_DROWI Protein crossbronx-like OS=Drosophila willistoni GN=GK15683 PE=3 SV=1 24 99 1.0E-07
sp|Q75EB8|UBC2_ASHGO Ubiquitin-conjugating enzyme E2 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=UBC2 PE=3 SV=1 16 95 2.0E-07
sp|Q6FR76|UBC2_CANGA Ubiquitin-conjugating enzyme E2 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=UBC2 PE=3 SV=1 16 95 2.0E-07
sp|Q5XGV8|AKTPB_XENLA AKT-interacting protein homolog B OS=Xenopus laevis GN=aktip-b PE=2 SV=1 3 99 2.0E-07
sp|B3MEZ6|AKTP1_DROAN Protein crossbronx OS=Drosophila ananassae GN=cbx PE=3 SV=1 20 107 3.0E-07
sp|B4LNV5|AKTP1_DROVI Protein crossbronx OS=Drosophila virilis GN=cbx PE=3 SV=1 16 135 3.0E-07
sp|B4KS18|AKTP2_DROMO Protein crossbronx-like OS=Drosophila mojavensis GN=GI18531 PE=3 SV=1 20 99 3.0E-07
sp|P0CS17|UBC2_CRYNB Ubiquitin-conjugating enzyme E2 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=UBC2 PE=3 SV=1 16 95 4.0E-07
sp|Q6BU36|UBC2_DEBHA Ubiquitin-conjugating enzyme E2 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=UBC2 PE=3 SV=1 21 95 4.0E-07
sp|Q7ZYX1|AKTIP_DANRE AKT-interacting protein OS=Danio rerio GN=aktip PE=2 SV=1 24 99 4.0E-07
sp|P0CS16|UBC2_CRYNJ Ubiquitin-conjugating enzyme E2 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=UBC2 PE=3 SV=1 16 95 4.0E-07
sp|P78717|UBC2_NECHA Ubiquitin-conjugating enzyme E2 2 OS=Nectria haematococca GN=UBC2 PE=3 SV=1 16 95 4.0E-07
sp|B4MQY1|AKTP1_DROWI Protein crossbronx OS=Drosophila willistoni GN=cbx PE=3 SV=1 20 135 5.0E-07
sp|B4HT57|AKTP1_DROSE Protein crossbronx OS=Drosophila sechellia GN=cbx PE=3 SV=1 20 99 5.0E-07
sp|B4QHS6|AKTP1_DROSI Protein crossbronx OS=Drosophila simulans GN=cbx PE=3 SV=1 20 99 5.0E-07
sp|P52493|UBC2_NEUCR Ubiquitin-conjugating enzyme E2 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-8 PE=3 SV=4 16 95 7.0E-07
sp|B3N6U7|AKTP1_DROER Protein crossbronx OS=Drosophila erecta GN=cbx PE=3 SV=1 20 135 9.0E-07
sp|Q7K4V4|AKTP1_DROME Protein crossbronx OS=Drosophila melanogaster GN=cbx PE=2 SV=1 20 99 9.0E-07
sp|B5X1G6|AKTIP_SALSA AKT-interacting protein OS=Salmo salar GN=aktip PE=2 SV=1 24 99 1.0E-06
sp|P49459|UBE2A_HUMAN Ubiquitin-conjugating enzyme E2 A OS=Homo sapiens GN=UBE2A PE=1 SV=2 16 95 1.0E-06
sp|Q9Z255|UBE2A_MOUSE Ubiquitin-conjugating enzyme E2 A OS=Mus musculus GN=Ube2a PE=1 SV=1 16 95 1.0E-06
sp|Q58FS2|UBC2_TRIHA Ubiquitin-conjugating enzyme E2 2 OS=Trichoderma harzianum GN=UBC2 PE=2 SV=1 16 95 1.0E-06
sp|P25866|UBC2_WHEAT Ubiquitin-conjugating enzyme E2 2 OS=Triticum aestivum GN=UBC2 PE=1 SV=1 16 95 1.0E-06
sp|Q498F8|AKTPA_XENLA AKT-interacting protein homolog A OS=Xenopus laevis GN=aktip-a PE=2 SV=1 24 99 2.0E-06
sp|P25153|UBCD6_DROME Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster GN=Ubc6 PE=2 SV=2 16 95 2.0E-06
sp|Q5ZJJ5|AKTIP_CHICK AKT-interacting protein OS=Gallus gallus GN=AKTIP PE=2 SV=1 24 99 3.0E-06
sp|Q6C093|UBC2_YARLI Ubiquitin-conjugating enzyme E2 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=UBC2 PE=3 SV=1 16 95 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8765
MAPLKGPLKALSLDGMPSLQRQHLLSEFAGLKQACPEGVFVSLTPGDPTLWTAVLFVRDGPYAQAVLRFHISFPD
CFPKLPPLVTFSTEMFHPLISPLTTYMYTTDIHDNGTVSARDDERLPPGGFSLRHGFPQWFGRGRRVLSGSRQVS
SEQARGPASAQTSRAPSSVSSPESGDGTVPSYMRRDRRDISVYHVLKYIRSTFDQDHVLDSVPLEAAGNPGAWHA
WRTHRRKLGKLPAAETTAEAAPPHEDDAASGQSPARSTASTAKRPGEWNWDGVWEDRVNKGIAASLSDAVLYGGS
GTDELIRFLAMEEGDVAAIKDNICRTLGSAA*
Coding >Hirsu2|8765
ATGGCTCCCCTCAAGGGCCCCCTCAAGGCCCTGTCTCTCGACGGCATGCCCTCGCTGCAGAGACAGCACCTGTTG
TCCGAGTTTGCCGGCCTGAAGCAGGCCTGCCCGGAAGGCGTCTTCGTCAGCCTGACTCCGGGCGACCCTACTCTG
TGGACGGCAGTCCTGTTTGTCCGCGATGGCCCCTACGCCCAGGCAGTTCTCCGATTCCACATCTCCTTTCCCGAC
TGCTTCCCGAAGCTGCCGCCCCTCGTCACCTTCTCTACCGAGATGTTTCATCCCTTAATCTCGCCCCTCACGACC
TACATGTACACCACCGACATCCATGACAACGGGACCGTCAGCGCCAGAGATGACGAGCGGCTGCCTCCTGGCGGA
TTCAGCCTGCGGCATGGCTTCCCCCAGTGGTTCGGGCGGGGCAGACGCGTCCTGTCTGGCAGCAGACAGGTCAGC
AGTGAGCAGGCCCGCGGCCCGGCCTCGGCCCAGACCAGCCGCGCCCCATCCAGCGTCAGCTCGCCAGAGTCCGGC
GACGGCACCGTGCCAAGCTACATGCGGAGAGATCGACGGGACATCTCCGTCTACCACGTCCTCAAGTACATCCGC
AGCACCTTCGACCAGGACCACGTTCTCGACTCCGTCCCGCTCGAGGCGGCCGGCAATCCCGGGGCCTGGCACGCC
TGGCGGACCCATCGTCGCAAGTTGGGCAAGCTGCCCGCCGCCGAAACGACGGCAGAGGCCGCCCCGCCGCACGAG
GACGACGCCGCTTCGGGCCAGAGCCCTGCCCGGTCCACCGCCTCAACCGCCAAGCGGCCGGGCGAGTGGAATTGG
GACGGTGTGTGGGAAGACAGGGTCAACAAGGGGATTGCTGCCAGCCTCTCCGACGCCGTCCTGTACGGCGGCTCT
GGCACAGACGAGCTGATTCGCTTTCTTGCCATGGAGGAGGGCGATGTGGCCGCCATCAAGGACAACATATGCCGC
ACGCTTGGCAGCGCAGCCTAG
Transcript >Hirsu2|8765
ATGGCTCCCCTCAAGGGCCCCCTCAAGGCCCTGTCTCTCGACGGCATGCCCTCGCTGCAGAGACAGCACCTGTTG
TCCGAGTTTGCCGGCCTGAAGCAGGCCTGCCCGGAAGGCGTCTTCGTCAGCCTGACTCCGGGCGACCCTACTCTG
TGGACGGCAGTCCTGTTTGTCCGCGATGGCCCCTACGCCCAGGCAGTTCTCCGATTCCACATCTCCTTTCCCGAC
TGCTTCCCGAAGCTGCCGCCCCTCGTCACCTTCTCTACCGAGATGTTTCATCCCTTAATCTCGCCCCTCACGACC
TACATGTACACCACCGACATCCATGACAACGGGACCGTCAGCGCCAGAGATGACGAGCGGCTGCCTCCTGGCGGA
TTCAGCCTGCGGCATGGCTTCCCCCAGTGGTTCGGGCGGGGCAGACGCGTCCTGTCTGGCAGCAGACAGGTCAGC
AGTGAGCAGGCCCGCGGCCCGGCCTCGGCCCAGACCAGCCGCGCCCCATCCAGCGTCAGCTCGCCAGAGTCCGGC
GACGGCACCGTGCCAAGCTACATGCGGAGAGATCGACGGGACATCTCCGTCTACCACGTCCTCAAGTACATCCGC
AGCACCTTCGACCAGGACCACGTTCTCGACTCCGTCCCGCTCGAGGCGGCCGGCAATCCCGGGGCCTGGCACGCC
TGGCGGACCCATCGTCGCAAGTTGGGCAAGCTGCCCGCCGCCGAAACGACGGCAGAGGCCGCCCCGCCGCACGAG
GACGACGCCGCTTCGGGCCAGAGCCCTGCCCGGTCCACCGCCTCAACCGCCAAGCGGCCGGGCGAGTGGAATTGG
GACGGTGTGTGGGAAGACAGGGTCAACAAGGGGATTGCTGCCAGCCTCTCCGACGCCGTCCTGTACGGCGGCTCT
GGCACAGACGAGCTGATTCGCTTTCTTGCCATGGAGGAGGGCGATGTGGCCGCCATCAAGGACAACATATGCCGC
ACGCTTGGCAGCGCAGCCTAG
Gene >Hirsu2|8765
ATGGCTCCCCTCAAGGGCCCCCTCAAGGCCCTGTCTCTCGACGGCATGCCCTCGCTGCAGAGACAGCACCTGTTG
TCCGAGTTGTGAGTCCGCGCGCGTCCCAGCTTCGTCGGCAGCACAGCTCACAGCTCGCTCTTTGCCAGTGCCGGC
CTGAAGCAGGCCTGCCCGGAAGGCGTCTTCGTCAGCCTGACTCCGGGCGACCCTACTCTGTGGACGGCAGTCCTG
TTTGTCCGCGATGGTGCGCATCCTCCCCGGCCCTCTCCCCCCTCCCCTGGCCGCTATCGGCACACGTGCTGATGC
GCGCCGCATCGTTCGCTTCTCGTCCAGGCCCCTACGCCCAGGCAGTTCTCCGATTCCACATCTCCTTTCCCGACT
GCTTCCCGAAGCTGCCGCCCCTCGTCACCTTCTCTACCGAGATGTTTCATCCCTTAATCTCGCCCCTCACGACCT
ACATGTACACCACCGACATCCATGACAACGGGACCGTCAGCGCCAGAGATGACGAGCGGCTGCCTCCTGGCGGAT
TCAGCCTGCGGCATGGCTTCCCCCAGTGGTTCGGGCGGGGCAGACGCGTCCTGTCTGGCAGCAGACAGGTCAGCA
GTGAGCAGGCCCGCGGCCCGGCCTCGGCCCAGACCAGCCGCGCCCCATCCAGCGTCAGCTCGCCAGAGTCCGGCG
ACGGCACCGTGCCAAGCTACATGCGGAGAGATCGACGGGACATCTCCGTCTACCACGTCCTCAAGTACATCCGCA
GCACCTTCGACCAGGACCACGTTCTCGACTCCGTCCCGCTCGAGGCGGCCGGCAATCCCGGGGCCTGGCACGCCT
GGCGGACCCATCGTCGCAAGTTGGGCAAGCTGCCCGCCGCCGAAACGACGGCAGAGGCCGCCCCGCCGCACGAGG
ACGACGCCGCTTCGGGCCAGAGCCCTGCCCGGTCCACCGCCTCAACCGCCAAGCGGCCGGGCGAGTGGAATTGGG
ACGGTGTGTGGGAAGACAGGGTCAACAAGGGGATTGCTGCCAGCCTCTCCGACGCCGTCCTGTACGGCGGCTCTG
GCACAGACGAGCTGGTAAGTGACGCCGCTACACCGCCGGAACGTGGCGAGACTGACCGGAGCCGCCCAGATTCGC
TTTCTTGCCATGGAGGAGGGCGATGTGGCCGCCATCAAGGACAACATATGCCGCACGCTTGGCAGCGCAGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail