Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8759
Gene name
LocationContig_593:9885..13362
Strand+
Gene length (bp)3477
Transcript length (bp)3270
Coding sequence length (bp)3270
Protein length (aa) 1090

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 9.6E-07 727 756

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87234|GYP3_SCHPO GTPase-activating protein gyp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp3 PE=1 SV=1 537 663 8.0E-34
sp|P48566|GYP3_YEAST GTPase-activating protein GYP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB3 PE=1 SV=1 540 665 2.0E-32
sp|Q12317|MSB4_YEAST GTPase-activating protein MSB4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB4 PE=1 SV=1 477 662 9.0E-32
sp|Q6PBU5|GRT1A_DANRE Growth hormone-regulated TBC protein 1-A OS=Danio rerio GN=grtp1a PE=2 SV=1 522 665 2.0E-15
sp|Q5TC63|GRTP1_HUMAN Growth hormone-regulated TBC protein 1 OS=Homo sapiens GN=GRTP1 PE=1 SV=4 540 665 2.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87234|GYP3_SCHPO GTPase-activating protein gyp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp3 PE=1 SV=1 537 663 8.0E-34
sp|P48566|GYP3_YEAST GTPase-activating protein GYP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB3 PE=1 SV=1 540 665 2.0E-32
sp|Q12317|MSB4_YEAST GTPase-activating protein MSB4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB4 PE=1 SV=1 477 662 9.0E-32
sp|Q6PBU5|GRT1A_DANRE Growth hormone-regulated TBC protein 1-A OS=Danio rerio GN=grtp1a PE=2 SV=1 522 665 2.0E-15
sp|Q5TC63|GRTP1_HUMAN Growth hormone-regulated TBC protein 1 OS=Homo sapiens GN=GRTP1 PE=1 SV=4 540 665 2.0E-14
sp|Q9D3N8|GRTP1_MOUSE Growth hormone-regulated TBC protein 1 OS=Mus musculus GN=Grtp1 PE=1 SV=1 540 665 2.0E-12
sp|Q6GLZ0|GRTP1_XENLA Growth hormone-regulated TBC protein 1 OS=Xenopus laevis GN=grtp1 PE=2 SV=1 540 663 1.0E-11
sp|O93870|FCR1_CANAX Fluconazole resistance protein 1 OS=Candida albicans GN=FCR1 PE=3 SV=1 721 795 2.0E-11
sp|Q6GL87|GRTP1_XENTR Growth hormone-regulated TBC protein 1 OS=Xenopus tropicalis GN=grtp1 PE=2 SV=1 540 663 6.0E-11
sp|Q5SVR0|TBC9B_MOUSE TBC1 domain family member 9B OS=Mus musculus GN=Tbc1d9b PE=1 SV=1 596 663 3.0E-06
sp|Q66K14|TBC9B_HUMAN TBC1 domain family member 9B OS=Homo sapiens GN=TBC1D9B PE=1 SV=3 595 663 4.0E-06
sp|Q9BXI6|TB10A_HUMAN TBC1 domain family member 10A OS=Homo sapiens GN=TBC1D10A PE=1 SV=1 564 662 5.0E-06
sp|P58802|TB10A_MOUSE TBC1 domain family member 10A OS=Mus musculus GN=Tbc1d10a PE=1 SV=1 565 662 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0008270 zinc ion binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0005634 nucleus Yes
GO:0043169 cation binding No
GO:0065007 biological regulation No
GO:0010468 regulation of gene expression No
GO:0019222 regulation of metabolic process No
GO:0050794 regulation of cellular process No
GO:0005488 binding No
GO:0046872 metal ion binding No
GO:0043229 intracellular organelle No
GO:0008150 biological_process No
GO:0051252 regulation of RNA metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0043226 organelle No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0060255 regulation of macromolecule metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043227 membrane-bounded organelle No
GO:2001141 regulation of RNA biosynthetic process No
GO:0043167 ion binding No
GO:0044424 intracellular part No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0050789 regulation of biological process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0044464 cell part No
GO:0031323 regulation of cellular metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0140110 transcription regulator activity No
GO:0003700 DNA-binding transcription factor activity No
GO:0046914 transition metal ion binding No
GO:0031326 regulation of cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8759
MAVSQFDDGAVERQRSVRNRQCSVYASRIRPAIAPLNLDAASAPGRVAPVPEVPPMPVSPRWDSLSNGSHLINHS
PTSSPGHPLDDSWSELPYRPFVASPARPVFEQPSSAAADGAESPGKSPSKAASAWAASKPRTFRSDVRSSDGVAV
ENFSRPRKQSIRQPVIPEQCAPEPAVPRLANLSPTDLLYEIGSTASPQTPPWPAPRRPSASSCKSASPFSSPLGP
PPPVELPEPRPPFAAGQRVDGNSASSPMAGSGAPPPWMADDELRSSFRSQLTASSAYGTALTERSSVLTKDSSVT
SLYANADEPSLEDVMCMYEKGFADDDDDDDDDDVEEDDEDTDFDEGPAADPHNRHHHHHHHHHHYHHAGNPSASP
ARAADAARHLEPAAASDQGRPVTAMSAPEPGDQSADVDLMPPLPPPARSALDAEIRQSKMIFTSPAFTASVPALS
AHVDLDVIAEKRDSGKSLDSEPSVSSDPASAANEGKKATATPLTSTPTSILSTSSTTTTKTTVSPPAIPPSPSSA
AFRAAMEPEDPGSRDRYGFKKQNQFITREQYDSWNKGYTQYLARRHKKWATYLKECGLMTDRPIRFPPPNAKTKR
FVRKGIPPDWRGAAWFYYAGGPAILAKHSGLYEKLLDREAKPIDVEAIERDLHRTFPDNIQFQPSPPAEDSKTTL
SRKNTTSSTSSKSVKSTSRVSKRANSTAAATVHHDHVAHGVGMDGRHKRVWKACERCRMKKTKCDGEFPCKRCKD
DGMVCTAGVRKKVEYKQLPKGYAEVLENTQFALIATVHKLYSMVRSAQPWELGEPELNDRGQPVIHNIAQRLGCI
RPNSDIDLPVHSVFPEDEAGMAELARQLEEQQQQRQAQAQAHHHHQQLMQQQQQQQQQPHHHHHQHHHQQHHPPP
PSDAAFSSHDTLDSASAKLSRTERGSSSELDQSDSELDYRPVPAGFRRAPPAFHAVSPPSFASTRASTGTTADFD
FSPPHAPAAAAEQHLDTASLFASTHSPAVPSGAAFPGWAVPPKVGHPQPGDEMTLHFMDHDGLPALGLNQTLVES
DFAALKADHLLPQPELNVMMGMGDPMICSAFVDGETMRL*
Coding >Hirsu2|8759
ATGGCCGTCTCCCAGTTCGACGACGGCGCCGTCGAGCGCCAGCGGAGTGTCCGCAACCGCCAGTGTTCCGTCTAT
GCATCCCGCATCAGGCCCGCCATCGCACCCCTGAACCTCGACGCCGCCTCGGCCCCGGGCCGCGTGGCCCCGGTG
CCCGAGGTGCCGCCCATGCCCGTCTCGCCGCGCTGGGATTCGCTGTCGAACGGATCCCACCTCATCAACCACAGC
CCGACGTCGTCGCCCGGCCACCCGCTCGACGACTCGTGGTCGGAGCTGCCGTACCGGCCCTTTGTCGCGTCGCCC
GCCCGGCCCGTCTTCGAGCAGCCGTCGAGCGCCGCCGCCGACGGGGCCGAGTCGCCCGGCAAATCGCCGTCCAAG
GCGGCCAGTGCCTGGGCGGCCAGCAAGCCGCGCACTTTTCGCTCCGACGTGCGCTCGTCGGACGGTGTGGCCGTG
GAGAATTTCTCGCGCCCGCGCAAGCAGAGCATCCGCCAGCCTGTCATCCCGGAACAATGTGCTCCGGAGCCGGCC
GTGCCGCGACTAGCCAACCTGTCGCCCACGGACCTCCTGTACGAGATTGGCTCGACCGCATCCCCCCAAACACCC
CCCTGGCCGGCTCCCAGACGGCCATCTGCCTCATCCTGCAAATCCGCGTCCCCCTTCTCCTCGCCCCTCGGCCCT
CCACCGCCCGTCGAACTGCCCGAACCAAGGCCCCCATTTGCCGCTGGCCAACGCGTCGACGGTAACAGCGCCTCG
TCGCCCATGGCCGGCAGTGGGGCCCCGCCGCCCTGGATGGCCGACGACGAGTTGCGGTCCAGTTTCAGGTCCCAA
CTCACCGCGTCGTCGGCCTACGGCACCGCCCTGACGGAGCGCAGCAGCGTCCTGACAAAGGACAGCTCCGTCACC
TCGCTCTACGCCAACGCCGACGAGCCCAGCCTCGAGGATGTTATGTGCATGTACGAGAAGGGCTTCGCTGACGAC
GACGACGACGACGACGACGACGACGTAGAAGAAGACGACGAAGACACCGACTTCGACGAAGGTCCCGCCGCCGAC
CCGCACAACCGTCACCACCACCACCACCACCATCACCACCACTACCACCACGCCGGCAACCCGTCGGCCAGCCCA
GCCCGCGCCGCCGACGCCGCCCGCCATCTCGAGCCCGCCGCCGCCTCGGATCAGGGCCGCCCCGTCACGGCCATG
TCGGCGCCCGAACCGGGCGACCAGTCTGCCGACGTCGACCTGATGCCGCCGCTGCCCCCCCCGGCCCGGTCTGCG
TTGGACGCCGAGATCCGCCAGTCCAAGATGATCTTCACCAGCCCCGCCTTCACCGCCTCCGTCCCGGCCCTGTCG
GCTCACGTCGACCTGGACGTCATCGCCGAGAAGCGCGACTCGGGCAAGTCGCTCGACTCGGAGCCCTCCGTCTCG
TCCGATCCCGCCTCGGCGGCCAATGAGGGCAAGAAGGCGACGGCGACGCCGCTGACGTCGACGCCGACATCGATA
TTGTCGACGTCGTCGACGACGACGACGAAGACGACGGTCTCGCCCCCCGCCATCCCGCCCTCACCCTCGTCGGCG
GCGTTCCGCGCGGCCATGGAGCCCGAGGACCCGGGCTCCCGCGACCGGTACGGCTTCAAGAAGCAGAACCAGTTC
ATCACGAGGGAGCAGTATGACTCGTGGAACAAGGGGTACACGCAGTACCTGGCCCGCAGGCACAAGAAGTGGGCC
ACGTACCTCAAGGAGTGCGGCCTGATGACGGACAGGCCTATACGTTTCCCGCCGCCCAACGCCAAGACGAAGCGG
TTCGTGCGCAAGGGCATCCCCCCGGACTGGCGAGGCGCCGCCTGGTTCTACTACGCCGGCGGTCCCGCCATCCTG
GCCAAGCACTCGGGCCTGTACGAGAAGCTGCTGGACCGCGAGGCCAAGCCGATCGACGTCGAGGCCATCGAGCGG
GACCTGCACCGGACGTTCCCCGACAACATCCAGTTCCAGCCGTCGCCGCCGGCCGAGGACAGCAAGACGACGCTG
TCGCGCAAGAACACGACGAGCTCGACGAGCTCCAAGTCGGTCAAGTCGACCAGCCGGGTCTCCAAGCGGGCCAAC
TCGACGGCCGCCGCCACCGTACACCACGACCACGTCGCCCATGGCGTCGGCATGGACGGCCGCCACAAGCGGGTG
TGGAAGGCGTGCGAGCGGTGTCGGATGAAGAAGACCAAGTGTGACGGCGAGTTTCCCTGCAAGCGATGCAAAGAC
GACGGCATGGTCTGCACGGCCGGCGTGAGGAAAAAGGTCGAATACAAGCAATTACCAAAGGGATACGCCGAGGTG
CTGGAGAACACGCAGTTCGCGCTCATCGCGACCGTCCACAAGCTGTACTCGATGGTGCGCAGCGCGCAGCCTTGG
GAGCTGGGCGAGCCCGAGCTCAACGACCGCGGGCAGCCGGTGATCCACAACATCGCGCAGCGGCTGGGCTGCATC
CGGCCCAACAGCGACATCGACCTGCCCGTCCACTCCGTCTTCCCCGAGGACGAGGCCGGCATGGCCGAGCTGGCG
CGGCAGCTGGAGGAGCAGCAGCAGCAGCGGCAGGCGCAGGCGCAGGCGCACCACCACCACCAGCAGCTGATGCAG
CAGCAGCAGCAGCAGCAGCAGCAGCCGCATCATCACCACCACCAGCACCACCACCAGCAGCACCACCCGCCGCCG
CCGAGCGACGCCGCCTTCAGCAGCCACGACACGCTCGACTCGGCCTCGGCCAAGCTCAGCCGCACCGAGCGCGGC
TCCTCGTCCGAGCTGGACCAGTCCGACAGCGAGCTCGACTACCGCCCGGTGCCGGCCGGCTTCCGGCGCGCCCCG
CCGGCCTTCCACGCCGTGTCGCCGCCCAGCTTCGCCAGCACGCGCGCCAGCACCGGCACCACGGCCGACTTCGAC
TTCAGCCCGCCGCACGCGCCCGCCGCCGCCGCCGAGCAGCACCTCGACACGGCCTCGCTCTTCGCCTCGACGCAC
TCGCCCGCCGTGCCCTCCGGCGCCGCCTTCCCCGGCTGGGCCGTGCCGCCCAAGGTCGGCCACCCGCAGCCGGGC
GACGAGATGACGCTGCACTTTATGGACCACGACGGCCTGCCCGCCCTCGGCCTCAACCAGACGCTCGTCGAGTCC
GACTTCGCCGCCCTCAAGGCCGACCACCTGCTGCCCCAGCCGGAGCTCAACGTCATGATGGGCATGGGCGACCCC
ATGATCTGCTCCGCCTTTGTCGACGGCGAGACCATGCGCCTCTAA
Transcript >Hirsu2|8759
ATGGCCGTCTCCCAGTTCGACGACGGCGCCGTCGAGCGCCAGCGGAGTGTCCGCAACCGCCAGTGTTCCGTCTAT
GCATCCCGCATCAGGCCCGCCATCGCACCCCTGAACCTCGACGCCGCCTCGGCCCCGGGCCGCGTGGCCCCGGTG
CCCGAGGTGCCGCCCATGCCCGTCTCGCCGCGCTGGGATTCGCTGTCGAACGGATCCCACCTCATCAACCACAGC
CCGACGTCGTCGCCCGGCCACCCGCTCGACGACTCGTGGTCGGAGCTGCCGTACCGGCCCTTTGTCGCGTCGCCC
GCCCGGCCCGTCTTCGAGCAGCCGTCGAGCGCCGCCGCCGACGGGGCCGAGTCGCCCGGCAAATCGCCGTCCAAG
GCGGCCAGTGCCTGGGCGGCCAGCAAGCCGCGCACTTTTCGCTCCGACGTGCGCTCGTCGGACGGTGTGGCCGTG
GAGAATTTCTCGCGCCCGCGCAAGCAGAGCATCCGCCAGCCTGTCATCCCGGAACAATGTGCTCCGGAGCCGGCC
GTGCCGCGACTAGCCAACCTGTCGCCCACGGACCTCCTGTACGAGATTGGCTCGACCGCATCCCCCCAAACACCC
CCCTGGCCGGCTCCCAGACGGCCATCTGCCTCATCCTGCAAATCCGCGTCCCCCTTCTCCTCGCCCCTCGGCCCT
CCACCGCCCGTCGAACTGCCCGAACCAAGGCCCCCATTTGCCGCTGGCCAACGCGTCGACGGTAACAGCGCCTCG
TCGCCCATGGCCGGCAGTGGGGCCCCGCCGCCCTGGATGGCCGACGACGAGTTGCGGTCCAGTTTCAGGTCCCAA
CTCACCGCGTCGTCGGCCTACGGCACCGCCCTGACGGAGCGCAGCAGCGTCCTGACAAAGGACAGCTCCGTCACC
TCGCTCTACGCCAACGCCGACGAGCCCAGCCTCGAGGATGTTATGTGCATGTACGAGAAGGGCTTCGCTGACGAC
GACGACGACGACGACGACGACGACGTAGAAGAAGACGACGAAGACACCGACTTCGACGAAGGTCCCGCCGCCGAC
CCGCACAACCGTCACCACCACCACCACCACCATCACCACCACTACCACCACGCCGGCAACCCGTCGGCCAGCCCA
GCCCGCGCCGCCGACGCCGCCCGCCATCTCGAGCCCGCCGCCGCCTCGGATCAGGGCCGCCCCGTCACGGCCATG
TCGGCGCCCGAACCGGGCGACCAGTCTGCCGACGTCGACCTGATGCCGCCGCTGCCCCCCCCGGCCCGGTCTGCG
TTGGACGCCGAGATCCGCCAGTCCAAGATGATCTTCACCAGCCCCGCCTTCACCGCCTCCGTCCCGGCCCTGTCG
GCTCACGTCGACCTGGACGTCATCGCCGAGAAGCGCGACTCGGGCAAGTCGCTCGACTCGGAGCCCTCCGTCTCG
TCCGATCCCGCCTCGGCGGCCAATGAGGGCAAGAAGGCGACGGCGACGCCGCTGACGTCGACGCCGACATCGATA
TTGTCGACGTCGTCGACGACGACGACGAAGACGACGGTCTCGCCCCCCGCCATCCCGCCCTCACCCTCGTCGGCG
GCGTTCCGCGCGGCCATGGAGCCCGAGGACCCGGGCTCCCGCGACCGGTACGGCTTCAAGAAGCAGAACCAGTTC
ATCACGAGGGAGCAGTATGACTCGTGGAACAAGGGGTACACGCAGTACCTGGCCCGCAGGCACAAGAAGTGGGCC
ACGTACCTCAAGGAGTGCGGCCTGATGACGGACAGGCCTATACGTTTCCCGCCGCCCAACGCCAAGACGAAGCGG
TTCGTGCGCAAGGGCATCCCCCCGGACTGGCGAGGCGCCGCCTGGTTCTACTACGCCGGCGGTCCCGCCATCCTG
GCCAAGCACTCGGGCCTGTACGAGAAGCTGCTGGACCGCGAGGCCAAGCCGATCGACGTCGAGGCCATCGAGCGG
GACCTGCACCGGACGTTCCCCGACAACATCCAGTTCCAGCCGTCGCCGCCGGCCGAGGACAGCAAGACGACGCTG
TCGCGCAAGAACACGACGAGCTCGACGAGCTCCAAGTCGGTCAAGTCGACCAGCCGGGTCTCCAAGCGGGCCAAC
TCGACGGCCGCCGCCACCGTACACCACGACCACGTCGCCCATGGCGTCGGCATGGACGGCCGCCACAAGCGGGTG
TGGAAGGCGTGCGAGCGGTGTCGGATGAAGAAGACCAAGTGTGACGGCGAGTTTCCCTGCAAGCGATGCAAAGAC
GACGGCATGGTCTGCACGGCCGGCGTGAGGAAAAAGGTCGAATACAAGCAATTACCAAAGGGATACGCCGAGGTG
CTGGAGAACACGCAGTTCGCGCTCATCGCGACCGTCCACAAGCTGTACTCGATGGTGCGCAGCGCGCAGCCTTGG
GAGCTGGGCGAGCCCGAGCTCAACGACCGCGGGCAGCCGGTGATCCACAACATCGCGCAGCGGCTGGGCTGCATC
CGGCCCAACAGCGACATCGACCTGCCCGTCCACTCCGTCTTCCCCGAGGACGAGGCCGGCATGGCCGAGCTGGCG
CGGCAGCTGGAGGAGCAGCAGCAGCAGCGGCAGGCGCAGGCGCAGGCGCACCACCACCACCAGCAGCTGATGCAG
CAGCAGCAGCAGCAGCAGCAGCAGCCGCATCATCACCACCACCAGCACCACCACCAGCAGCACCACCCGCCGCCG
CCGAGCGACGCCGCCTTCAGCAGCCACGACACGCTCGACTCGGCCTCGGCCAAGCTCAGCCGCACCGAGCGCGGC
TCCTCGTCCGAGCTGGACCAGTCCGACAGCGAGCTCGACTACCGCCCGGTGCCGGCCGGCTTCCGGCGCGCCCCG
CCGGCCTTCCACGCCGTGTCGCCGCCCAGCTTCGCCAGCACGCGCGCCAGCACCGGCACCACGGCCGACTTCGAC
TTCAGCCCGCCGCACGCGCCCGCCGCCGCCGCCGAGCAGCACCTCGACACGGCCTCGCTCTTCGCCTCGACGCAC
TCGCCCGCCGTGCCCTCCGGCGCCGCCTTCCCCGGCTGGGCCGTGCCGCCCAAGGTCGGCCACCCGCAGCCGGGC
GACGAGATGACGCTGCACTTTATGGACCACGACGGCCTGCCCGCCCTCGGCCTCAACCAGACGCTCGTCGAGTCC
GACTTCGCCGCCCTCAAGGCCGACCACCTGCTGCCCCAGCCGGAGCTCAACGTCATGATGGGCATGGGCGACCCC
ATGATCTGCTCCGCCTTTGTCGACGGCGAGACCATGCGCCTCTAA
Gene >Hirsu2|8759
ATGGCCGTCTCCCAGTTCGACGACGGCGCCGTCGAGCGCCAGCGGAGTGTCCGCAACCGCCAGTGTTCCGTCTAT
GCATCCCGCATCAGGCCCGCCATCGCACCCCTGAACCTCGACGCCGCCTCGGCCCCGGGCCGCGTGGCCCCGGTG
CCCGAGGTGCCGCCCATGCCCGTCTCGCCGCGCTGGGATTCGCTGTCGAACGGATCCCACCTCATCAACCACAGC
CCGACGTCGTCGCCCGGCCACCCGCTCGACGACTCGTGGTCGGAGCTGCCGTACCGGCCCTTTGTCGCGTCGCCC
GCCCGGCCCGTCTTCGAGCAGCCGTCGAGCGCCGCCGCCGACGGGGCCGAGTCGCCCGGCAAATCGCCGTCCAAG
GCGGCCAGTGCCTGGGCGGCCAGCAAGCCGCGCACTTTTCGCTCCGACGTGCGCTCGTCGGACGGTGTGGCCGTG
GAGAATTTCTCGCGCCCGCGCAAGCAGAGCATCCGCCAGCCTGTCATCCCGGAACAATGTGCTCCGGAGCCGGCC
GTGCCGCGACTAGCCAACCTGTCGCCCACGGACCTCCTGTACGAGATTGGCTCGACCGCATCCCCCCAAACACCC
CCCTGGCCGGCTCCCAGACGGCCATCTGCCTCATCCTGCAAATCCGCGTCCCCCTTCTCCTCGCCCCTCGGCCCT
CCACCGCCCGTCGAACTGCCCGAACCAAGGTTTGCCCGTATCCGGAATGCCGCCGGCCCGCCCCTAACGGCCGCC
AGGCCCCCATTTGCCGCTGGCCAACGCGTCGACGGTAACAGCGCCTCGTCGCCCATGGCCGGCAGTGGGGCCCCG
CCGCCCTGGATGGCCGACGACGAGTTGCGGTCCAGTTTCAGGTCCCAACTCACCGCGTCGTCGGCCTACGGCACC
GCCCTGACGGAGCGCAGCAGCGTCCTGACAAAGGACAGCTCCGTCACCTCGCTCTACGCCAACGCCGACGAGCCC
AGCCTCGAGGATGTTATGTGCATGTACGAGAAGGGCTTCGCTGACGACGACGACGACGACGACGACGACGACGTA
GAAGAAGACGACGAAGACACCGACTTCGACGAAGGTCCCGCCGCCGACCCGCACAACCGTCACCACCACCACCAC
CACCATCACCACCACTACCACCACGCCGGCAACCCGTCGGCCAGCCCAGCCCGCGCCGCCGACGCCGCCCGCCAT
CTCGAGCCCGCCGCCGCCTCGGATCAGGGCCGCCCCGTCACGGCCATGTCGGCGCCCGAACCGGGCGACCAGTCT
GCCGACGTCGACCTGATGCCGCCGCTGCCCCCCCCGGCCCGGTCTGCGTTGGACGCCGAGATCCGCCAGTCCAAG
ATGATCTTCACCAGCCCCGCCTTCACCGCCTCCGTCCCGGCCCTGTCGGCTCACGTCGACCTGGACGTCATCGCC
GAGAAGCGCGACTCGGGCAAGTCGCTCGACTCGGAGCCCTCCGTCTCGTCCGATCCCGCCTCGGCGGCCAATGAG
GGCAAGAAGGCGACGGCGACGCCGCTGACGTCGACGCCGACATCGATATTGTCGACGTCGTCGACGACGACGACG
AAGACGACGGTCTCGCCCCCCGCCATCCCGCCCTCACCCTCGTCGGCGGCGTTCCGCGCGGCCATGGAGCCCGAG
GACCCGGGCTCCCGCGACCGGTACGGCTTCAAGAAGCAGAACCAGTTCATCACGAGGGAGCAGTATGACTCGTGG
AACAAGGGGTACACGCAGTACCTGGCCCGCAGGCACAAGAAGTGGGCCACGTACCTCAAGGAGTGCGGCCTGATG
ACGGACAGGCCTATACGTTTCCCGCCGCCCAACGCCAAGACGAAGCGGTTCGTGCGCAAGGGCATCCCCCCGGAC
TGGCGAGGCGCCGCCTGGTTCTACTACGCCGGCGGTCCCGCCATCCTGGCCAAGCACTCGGGCCTGTACGAGAAG
CTGCTGGACCGCGAGGCCAAGCCGATCGACGTCGAGGCCATCGAGCGGGACCTGCACCGGACGTTCCCCGACAAC
ATCCAGTTCCAGCCGTCGCCGCCGGCCGAGGACAGCAAGACGACGCTGTCGCGCAAGAACACGACGAGCTCGACG
AGCTCCAAGTCGGTCAAGTCGACCAGCCGGGTCTCCAAGCGGGCCAACTCGACGGCCGCCGCCACCGTACACCAC
GACCACGTCGCCCATGGCGTCGGCATGGACGGCCGCCACAAGCGGGTGTGGAAGGCGTGCGAGCGGTGTCGGATG
AAGAAGACCAAGGTTCGTCCACTTGCTCGCGAGAGAGAGAGAGAGAGAAGCAGGACAGGGAGGGGCTGACTCTGG
GCCGCAGTGTGACGGCGAGTTTCCCTGCAAGCGATGCAAAGACGACGGCATGGTCTGCACGGCCGGCGTGAGGAA
AAAGGTCGAATACAAGCAATTACCAAAGGGGTATGTCTCGTCGCTTTCCCGTCTCTTCGTGCCCGCATACCAGAC
TCGCTCGTTCCCAACGCTGACCGGCGCCGCCTCCGCTTCTGCAGATACGCCGAGGTGCTGGAGAACACGCAGTTC
GCGCTCATCGCGACCGTCCACAAGCTGTACTCGATGGTGCGCAGCGCGCAGCCTTGGGAGCTGGGCGAGCCCGAG
CTCAACGACCGCGGGCAGCCGGTGATCCACAACATCGCGCAGCGGCTGGGCTGCATCCGGCCCAACAGCGACATC
GACCTGCCCGTCCACTCCGTCTTCCCCGAGGACGAGGCCGGCATGGCCGAGCTGGCGCGGCAGCTGGAGGAGCAG
CAGCAGCAGCGGCAGGCGCAGGCGCAGGCGCACCACCACCACCAGCAGCTGATGCAGCAGCAGCAGCAGCAGCAG
CAGCAGCCGCATCATCACCACCACCAGCACCACCACCAGCAGCACCACCCGCCGCCGCCGAGCGACGCCGCCTTC
AGCAGCCACGACACGCTCGACTCGGCCTCGGCCAAGCTCAGCCGCACCGAGCGCGGCTCCTCGTCCGAGCTGGAC
CAGTCCGACAGCGAGCTCGACTACCGCCCGGTGCCGGCCGGCTTCCGGCGCGCCCCGCCGGCCTTCCACGCCGTG
TCGCCGCCCAGCTTCGCCAGCACGCGCGCCAGCACCGGCACCACGGCCGACTTCGACTTCAGCCCGCCGCACGCG
CCCGCCGCCGCCGCCGAGCAGCACCTCGACACGGCCTCGCTCTTCGCCTCGACGCACTCGCCCGCCGTGCCCTCC
GGCGCCGCCTTCCCCGGCTGGGCCGTGCCGCCCAAGGTCGGCCACCCGCAGCCGGGCGACGAGATGACGCTGCAC
TTTATGGACCACGACGGCCTGCCCGCCCTCGGCCTCAACCAGACGCTCGTCGAGTCCGACTTCGCCGCCCTCAAG
GCCGACCACCTGCTGCCCCAGCCGGAGCTCAACGTCATGATGGGCATGGGCGACCCCATGATCTGCTCCGCCTTT
GTCGACGGCGAGACCATGCGCCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail