Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8753
Gene name
LocationContig_592:4834..7844
Strand-
Gene length (bp)3010
Transcript length (bp)2958
Coding sequence length (bp)2958
Protein length (aa) 986

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00773 RNB RNB domain 6.1E-97 515 846
PF17216 Rrp44_CSD1 Rrp44-like cold shock domain 3.6E-30 250 386
PF17215 Rrp44_S1 S1 domain 8.0E-28 898 980
PF17849 OB_Dis3 Dis3-like cold-shock domain 2 (CSD2) 7.9E-19 413 479
PF13638 PIN_4 PIN domain 5.9E-09 88 214

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P37202|DIS3_SCHPO Exosome complex exonuclease dis3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dis3 PE=1 SV=1 1 983 0.0E+00
sp|Q08162|RRP44_YEAST Exosome complex exonuclease DIS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIS3 PE=1 SV=1 5 982 0.0E+00
sp|Q9CSH3|RRP44_MOUSE Exosome complex exonuclease RRP44 OS=Mus musculus GN=Dis3 PE=1 SV=4 17 983 0.0E+00
sp|Q9Y2L1|RRP44_HUMAN Exosome complex exonuclease RRP44 OS=Homo sapiens GN=DIS3 PE=1 SV=2 17 983 0.0E+00
sp|Q9SHL7|RP44A_ARATH Exosome complex exonuclease RRP44 homolog A OS=Arabidopsis thaliana GN=RRP44A PE=2 SV=2 17 926 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P37202|DIS3_SCHPO Exosome complex exonuclease dis3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dis3 PE=1 SV=1 1 983 0.0E+00
sp|Q08162|RRP44_YEAST Exosome complex exonuclease DIS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIS3 PE=1 SV=1 5 982 0.0E+00
sp|Q9CSH3|RRP44_MOUSE Exosome complex exonuclease RRP44 OS=Mus musculus GN=Dis3 PE=1 SV=4 17 983 0.0E+00
sp|Q9Y2L1|RRP44_HUMAN Exosome complex exonuclease RRP44 OS=Homo sapiens GN=DIS3 PE=1 SV=2 17 983 0.0E+00
sp|Q9SHL7|RP44A_ARATH Exosome complex exonuclease RRP44 homolog A OS=Arabidopsis thaliana GN=RRP44A PE=2 SV=2 17 926 0.0E+00
sp|Q17632|RRP44_CAEEL Probable exosome complex exonuclease RRP44 OS=Caenorhabditis elegans GN=dis-3 PE=3 SV=2 26 939 0.0E+00
sp|A0JN80|DI3L1_BOVIN DIS3-like exonuclease 1 OS=Bos taurus GN=DIS3L PE=2 SV=2 20 965 8.0E-166
sp|Q5U2P0|DI3L1_RAT DIS3-like exonuclease 1 OS=Rattus norvegicus GN=Dis3l PE=2 SV=2 20 965 3.0E-162
sp|Q8C0S1|DI3L1_MOUSE DIS3-like exonuclease 1 OS=Mus musculus GN=Dis3l PE=1 SV=2 20 965 4.0E-161
sp|Q5R5N8|DI3L1_PONAB DIS3-like exonuclease 1 OS=Pongo abelii GN=DIS3L PE=2 SV=1 20 965 6.0E-159
sp|Q8TF46|DI3L1_HUMAN DIS3-like exonuclease 1 OS=Homo sapiens GN=DIS3L PE=1 SV=2 20 965 5.0E-158
sp|Q6GN11|DI3L1_XENLA DIS3-like exonuclease 1 OS=Xenopus laevis GN=dis3l PE=2 SV=2 18 966 1.0E-153
sp|A2RV18|DI3L1_DANRE DIS3-like exonuclease 1 OS=Danio rerio GN=dis3l PE=2 SV=1 18 928 8.0E-151
sp|Q0P4R5|DI3L1_XENTR DIS3-like exonuclease 1 OS=Xenopus tropicalis GN=dis3l PE=2 SV=2 29 965 2.0E-149
sp|Q0V9R3|DI3L2_XENTR DIS3-like exonuclease 2 OS=Xenopus tropicalis GN=dis3l2 PE=2 SV=2 250 931 2.0E-103
sp|Q8CI75|DI3L2_MOUSE DIS3-like exonuclease 2 OS=Mus musculus GN=Dis3l2 PE=1 SV=1 250 931 6.0E-100
sp|Q8IYB7|DI3L2_HUMAN DIS3-like exonuclease 2 OS=Homo sapiens GN=DIS3L2 PE=1 SV=4 250 931 2.0E-97
sp|O14040|DI3L2_SCHPO DIS3-like exonuclease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dis32 PE=1 SV=1 244 926 2.0E-93
sp|Q09568|DI3L2_CAEEL DIS3-like exonuclease 2 OS=Caenorhabditis elegans GN=F48E8.6 PE=3 SV=2 250 920 5.0E-89
sp|P0DM58|DI3L2_ARATH DIS3-like exonuclease 2 OS=Arabidopsis thaliana GN=SOV PE=1 SV=1 250 840 4.0E-73
sp|Q0WPN0|DI32L_ARATH Inactive exonuclease DIS3L2 OS=Arabidopsis thaliana GN=SOV PE=2 SV=1 250 840 1.0E-71
sp|Q9WZI1|RNR_THEMA Ribonuclease R OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rnr PE=3 SV=1 373 929 2.0E-50
sp|O32231|RNR_BACSU Ribonuclease R OS=Bacillus subtilis (strain 168) GN=rnr PE=2 SV=1 357 926 1.0E-46
sp|Q9Z848|RNR_CHLPN Ribonuclease R OS=Chlamydia pneumoniae GN=rnr PE=3 SV=1 436 929 1.0E-46
sp|Q9CH00|RNR1_LACLA Ribonuclease R 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rnr1 PE=3 SV=1 456 965 1.0E-45
sp|O67834|RNR_AQUAE Ribonuclease R OS=Aquifex aeolicus (strain VF5) GN=rnr PE=3 SV=1 515 969 7.0E-45
sp|O84402|RNR_CHLTR Ribonuclease R OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rnr PE=3 SV=1 436 948 2.0E-44
sp|Q5AK62|SSD1_CANAL Virulence protein SSD1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSD1 PE=2 SV=1 248 939 1.0E-43
sp|Q9PK00|RNR_CHLMU Ribonuclease R OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rnr PE=3 SV=1 436 924 2.0E-43
sp|Q02146|RNR2_LACLA Ribonuclease R 2 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rnr2 PE=3 SV=3 509 965 2.0E-43
sp|Q9PR88|RNR_UREPA Ribonuclease R OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=rnr PE=3 SV=1 523 965 1.0E-41
sp|Q98QL0|RNR_MYCPU Ribonuclease R OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rnr PE=3 SV=1 457 846 7.0E-39
sp|P21499|RNR_ECOLI Ribonuclease R OS=Escherichia coli (strain K12) GN=rnr PE=1 SV=2 434 852 5.0E-37
sp|P30851|RNR_SHIFL Ribonuclease R OS=Shigella flexneri GN=rnr PE=3 SV=4 434 852 1.0E-36
sp|P40611|RNR_VIBPA Ribonuclease R OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rnr PE=3 SV=2 414 946 4.0E-36
sp|P44907|RNR_HAEIN Ribonuclease R OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rnr PE=3 SV=1 441 965 9.0E-36
sp|Q9KNY1|RNR_VIBCH Ribonuclease R OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rnr PE=3 SV=1 441 965 1.0E-35
sp|P24276|SSD1_YEAST Protein SSD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSD1 PE=1 SV=1 392 939 1.0E-30
sp|O74454|STS5_SCHPO Protein sts5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sts5 PE=1 SV=1 245 842 2.0E-30
sp|P75529|RNR_MYCPN Ribonuclease R OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=rnr PE=3 SV=1 515 952 4.0E-30
sp|Q8K917|RNR_BUCAP Ribonuclease R OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rnr PE=3 SV=1 508 951 9.0E-30
sp|P47350|RNR_MYCGE Ribonuclease R OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rnr PE=3 SV=1 497 953 3.0E-29
sp|P56123|RNR_HELPY Ribonuclease R OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rnr PE=3 SV=1 407 883 3.0E-28
sp|O94525|YBU1_SCHPO Uncharacterized ribonuclease C609.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC609.01 PE=3 SV=1 204 945 4.0E-28
sp|P57628|RNR_BUCAI Ribonuclease R OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rnr PE=3 SV=2 501 929 1.0E-27
sp|P54084|RNR_ACIFR Ribonuclease R (Fragment) OS=Acidithiobacillus ferrooxidans GN=rnr PE=3 SV=2 349 672 5.0E-27
sp|Q87IJ9|RNB_VIBPA Exoribonuclease 2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rnb PE=3 SV=1 495 846 1.0E-26
sp|Q9ZJX9|RNR_HELPJ Ribonuclease R OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rnr PE=3 SV=1 407 883 3.0E-26
sp|C3LW69|RNB_VIBCM Exoribonuclease 2 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rnb PE=3 SV=1 500 916 6.0E-26
sp|Q9KLE1|RNB_VIBCH Exoribonuclease 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rnb PE=3 SV=1 500 916 6.0E-26
sp|Q7MEL4|RNB_VIBVY Exoribonuclease 2 OS=Vibrio vulnificus (strain YJ016) GN=rnb PE=3 SV=2 455 846 1.0E-25
sp|A5F0G1|RNB_VIBC3 Exoribonuclease 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rnb PE=3 SV=1 500 916 2.0E-25
sp|Q8D7K6|RNB_VIBVU Exoribonuclease 2 OS=Vibrio vulnificus (strain CMCP6) GN=rnb PE=3 SV=1 455 846 4.0E-25
sp|B7VSB8|RNB_VIBTL Exoribonuclease 2 OS=Vibrio tasmaniensis (strain LGP32) GN=rnb PE=3 SV=1 495 846 5.0E-25
sp|D3V184|RNB_XENBS Exoribonuclease 2 OS=Xenorhabdus bovienii (strain SS-2004) GN=rnb PE=3 SV=1 470 916 2.0E-24
sp|B4EW02|RNB_PROMH Exoribonuclease 2 OS=Proteus mirabilis (strain HI4320) GN=rnb PE=3 SV=1 515 916 3.0E-24
sp|Q1LTG8|RNB_BAUCH Exoribonuclease 2 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rnb PE=3 SV=1 515 923 1.0E-22
sp|B7LRZ1|RNB_ESCF3 Exoribonuclease 2 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rnb PE=3 SV=1 515 916 4.0E-22
sp|D0Z8E6|RNB_EDWTE Exoribonuclease 2 OS=Edwardsiella tarda (strain EIB202) GN=rnb PE=3 SV=2 515 916 5.0E-22
sp|A7MMD8|RNB_CROS8 Exoribonuclease 2 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rnb PE=3 SV=1 515 916 6.0E-22
sp|Q8K9Q5|RNB_BUCAP Exoribonuclease 2 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rnb PE=3 SV=1 515 847 7.0E-22
sp|B2VKS8|RNB_ERWT9 Exoribonuclease 2 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rnb PE=3 SV=1 494 849 7.0E-21
sp|Q9BYK8|HELZ2_HUMAN Helicase with zinc finger domain 2 OS=Homo sapiens GN=HELZ2 PE=1 SV=6 290 906 1.0E-20
sp|A8GF49|RNB_SERP5 Exoribonuclease 2 OS=Serratia proteamaculans (strain 568) GN=rnb PE=3 SV=1 515 916 1.0E-20
sp|Q6D5S7|RNB_PECAS Exoribonuclease 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rnb PE=3 SV=1 515 916 2.0E-20
sp|A1AAQ4|RNB_ECOK1 Exoribonuclease 2 OS=Escherichia coli O1:K1 / APEC GN=rnb PE=3 SV=1 515 916 3.0E-20
sp|B7MLW3|RNB_ECO45 Exoribonuclease 2 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rnb PE=3 SV=1 515 916 3.0E-20
sp|Q2NST6|RNB_SODGM Exoribonuclease 2 OS=Sodalis glossinidius (strain morsitans) GN=rnb PE=3 SV=1 515 916 4.0E-20
sp|E9QAM5|HELZ2_MOUSE Helicase with zinc finger domain 2 OS=Mus musculus GN=Helz2 PE=1 SV=1 515 895 4.0E-20
sp|Q7VLX8|RNB_HAEDU Exoribonuclease 2 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rnb PE=3 SV=1 515 967 5.0E-20
sp|Q8FHT6|RNB_ECOL6 Exoribonuclease 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rnb PE=3 SV=1 515 916 6.0E-20
sp|Q0TI78|RNB_ECOL5 Exoribonuclease 2 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rnb PE=3 SV=1 515 916 6.0E-20
sp|C6DK05|RNB_PECCP Exoribonuclease 2 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rnb PE=3 SV=1 515 916 6.0E-20
sp|A4WAX5|RNB_ENT38 Exoribonuclease 2 OS=Enterobacter sp. (strain 638) GN=rnb PE=3 SV=1 514 916 6.0E-20
sp|B4T6U4|RNB_SALNS Exoribonuclease 2 OS=Salmonella newport (strain SL254) GN=rnb PE=3 SV=1 514 916 6.0E-20
sp|Q7N4F5|RNB_PHOLL Exoribonuclease 2 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rnb PE=3 SV=1 470 963 7.0E-20
sp|B7N4A3|RNB_ECOLU Exoribonuclease 2 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rnb PE=3 SV=1 515 916 7.0E-20
sp|A0KFR1|RNB_AERHH Exoribonuclease 2 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rnb PE=3 SV=1 495 847 9.0E-20
sp|A6T7Z4|RNB_KLEP7 Exoribonuclease 2 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rnb PE=3 SV=1 515 916 1.0E-19
sp|B7UR96|RNB_ECO27 Exoribonuclease 2 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rnb PE=3 SV=1 515 849 1.0E-19
sp|Q8Z7C9|RNB_SALTI Exoribonuclease 2 OS=Salmonella typhi GN=rnb PE=3 SV=1 514 916 2.0E-19
sp|A9MQ20|RNB_SALAR Exoribonuclease 2 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rnb PE=3 SV=1 514 916 2.0E-19
sp|B5R490|RNB_SALEP Exoribonuclease 2 OS=Salmonella enteritidis PT4 (strain P125109) GN=rnb PE=3 SV=1 514 916 2.0E-19
sp|B4TJI0|RNB_SALHS Exoribonuclease 2 OS=Salmonella heidelberg (strain SL476) GN=rnb PE=3 SV=1 514 916 3.0E-19
sp|B5FU93|RNB_SALDC Exoribonuclease 2 OS=Salmonella dublin (strain CT_02021853) GN=rnb PE=3 SV=1 514 916 3.0E-19
sp|C0Q3R1|RNB_SALPC Exoribonuclease 2 OS=Salmonella paratyphi C (strain RKS4594) GN=rnb PE=3 SV=1 514 916 3.0E-19
sp|Q57NV9|RNB_SALCH Exoribonuclease 2 OS=Salmonella choleraesuis (strain SC-B67) GN=rnb PE=3 SV=1 514 916 3.0E-19
sp|B5R9Y0|RNB_SALG2 Exoribonuclease 2 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rnb PE=3 SV=1 514 916 3.0E-19
sp|B4TX11|RNB_SALSV Exoribonuclease 2 OS=Salmonella schwarzengrund (strain CVM19633) GN=rnb PE=3 SV=1 514 916 3.0E-19
sp|B5F571|RNB_SALA4 Exoribonuclease 2 OS=Salmonella agona (strain SL483) GN=rnb PE=3 SV=1 514 916 3.0E-19
sp|B5XS03|RNB_KLEP3 Exoribonuclease 2 OS=Klebsiella pneumoniae (strain 342) GN=rnb PE=3 SV=1 515 916 3.0E-19
sp|Q8ZP54|RNB_SALTY Exoribonuclease 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rnb PE=3 SV=1 514 916 3.0E-19
sp|A9MWU8|RNB_SALPB Exoribonuclease 2 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rnb PE=3 SV=1 514 916 3.0E-19
sp|Q32GP4|RNB_SHIDS Exoribonuclease 2 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rnb PE=3 SV=1 515 916 3.0E-19
sp|B5BIE3|RNB_SALPK Exoribonuclease 2 OS=Salmonella paratyphi A (strain AKU_12601) GN=rnb PE=3 SV=1 514 916 4.0E-19
sp|Q5PCZ6|RNB_SALPA Exoribonuclease 2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rnb PE=3 SV=1 514 916 4.0E-19
sp|B6IA03|RNB_ECOSE Exoribonuclease 2 OS=Escherichia coli (strain SE11) GN=rnb PE=3 SV=1 515 916 4.0E-19
sp|P30850|RNB_ECOLI Exoribonuclease 2 OS=Escherichia coli (strain K12) GN=rnb PE=1 SV=3 515 916 4.0E-19
sp|B1XBN7|RNB_ECODH Exoribonuclease 2 OS=Escherichia coli (strain K12 / DH10B) GN=rnb PE=3 SV=1 515 916 4.0E-19
sp|C4ZTY2|RNB_ECOBW Exoribonuclease 2 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rnb PE=3 SV=1 515 916 4.0E-19
sp|B7LY47|RNB_ECO8A Exoribonuclease 2 OS=Escherichia coli O8 (strain IAI1) GN=rnb PE=3 SV=1 515 916 4.0E-19
sp|B7NVR1|RNB_ECO7I Exoribonuclease 2 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rnb PE=3 SV=1 515 916 4.0E-19
sp|B7L4C3|RNB_ECO55 Exoribonuclease 2 OS=Escherichia coli (strain 55989 / EAEC) GN=rnb PE=3 SV=1 515 916 4.0E-19
sp|A7ZLA9|RNB_ECO24 Exoribonuclease 2 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rnb PE=3 SV=1 515 916 4.0E-19
sp|Q1RC77|RNB_ECOUT Exoribonuclease 2 OS=Escherichia coli (strain UTI89 / UPEC) GN=rnb PE=3 SV=1 515 916 4.0E-19
sp|Q31ZY2|RNB_SHIBS Exoribonuclease 2 OS=Shigella boydii serotype 4 (strain Sb227) GN=rnb PE=3 SV=1 515 916 5.0E-19
sp|B2U0I4|RNB_SHIB3 Exoribonuclease 2 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rnb PE=3 SV=1 515 916 5.0E-19
sp|B3GXJ4|RNB_ACTP7 Exoribonuclease 2 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rnb PE=3 SV=1 514 965 5.0E-19
sp|B1ITG7|RNB_ECOLC Exoribonuclease 2 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rnb PE=3 SV=1 515 916 6.0E-19
sp|A7ZZM6|RNB_ECOHS Exoribonuclease 2 OS=Escherichia coli O9:H4 (strain HS) GN=rnb PE=3 SV=1 515 916 6.0E-19
sp|B1LGE7|RNB_ECOSM Exoribonuclease 2 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rnb PE=3 SV=1 515 916 6.0E-19
sp|A8AG96|RNB_CITK8 Exoribonuclease 2 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rnb PE=3 SV=1 515 851 1.0E-18
sp|Q3Z135|RNB_SHISS Exoribonuclease 2 OS=Shigella sonnei (strain Ss046) GN=rnb PE=3 SV=1 515 849 1.0E-18
sp|B5YZR8|RNB_ECO5E Exoribonuclease 2 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rnb PE=3 SV=1 515 916 1.0E-18
sp|Q8X7D6|RNB_ECO57 Exoribonuclease 2 OS=Escherichia coli O157:H7 GN=rnb PE=3 SV=1 515 916 1.0E-18
sp|P57354|RNB_BUCAI Exoribonuclease 2 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rnb PE=3 SV=1 463 916 1.0E-18
sp|B8D7G3|RNB_BUCAT Exoribonuclease 2 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=rnb PE=3 SV=1 514 849 2.0E-18
sp|B8D959|RNB_BUCA5 Exoribonuclease 2 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=rnb PE=3 SV=1 514 849 2.0E-18
sp|Q0T5B1|RNB_SHIF8 Exoribonuclease 2 OS=Shigella flexneri serotype 5b (strain 8401) GN=rnb PE=3 SV=1 515 849 2.0E-18
sp|A1SWZ6|RNB_PSYIN Exoribonuclease 2 OS=Psychromonas ingrahamii (strain 37) GN=rnb PE=3 SV=1 495 846 2.0E-18
sp|P59107|RNB_SHIFL Exoribonuclease 2 OS=Shigella flexneri GN=rnb PE=3 SV=1 515 849 2.0E-18
sp|B8F4C5|RNB_HAEPS Exoribonuclease 2 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rnb PE=3 SV=1 514 967 4.0E-18
sp|B0BP37|RNB_ACTPJ Exoribonuclease 2 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rnb PE=3 SV=1 514 965 6.0E-18
sp|A5UFG3|RNB_HAEIG Exoribonuclease 2 OS=Haemophilus influenzae (strain PittGG) GN=rnb PE=3 SV=1 513 955 7.0E-18
sp|P44440|RNB_HAEIN Exoribonuclease 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rnb PE=3 SV=1 513 955 7.0E-18
sp|Q6NQJ6|RNR1_ARATH Ribonuclease II, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=RNR1 PE=2 SV=1 417 915 1.0E-17
sp|A3N0B9|RNB_ACTP2 Exoribonuclease 2 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rnb PE=3 SV=1 514 965 1.0E-17
sp|P73177|RN2H_SYNY3 Uncharacterized ribonuclease sll1290 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1290 PE=3 SV=1 513 892 2.0E-17
sp|Q66AH3|RNB_YERPS Exoribonuclease 2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rnb PE=3 SV=1 514 916 7.0E-17
sp|B2K4J2|RNB_YERPB Exoribonuclease 2 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rnb PE=3 SV=1 514 916 7.0E-17
sp|Q65SI5|RNB_MANSM Exoribonuclease 2 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rnb PE=3 SV=1 515 862 1.0E-16
sp|A1JM34|RNB_YERE8 Exoribonuclease 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rnb PE=3 SV=1 515 846 1.0E-16
sp|A7FI01|RNB_YERP3 Exoribonuclease 2 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rnb PE=3 SV=1 514 916 1.0E-16
sp|B1JKP2|RNB_YERPY Exoribonuclease 2 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rnb PE=3 SV=1 514 916 1.0E-16
sp|A4TJ37|RNB_YERPP Exoribonuclease 2 OS=Yersinia pestis (strain Pestoides F) GN=rnb PE=3 SV=1 514 916 1.0E-16
sp|Q1CIZ7|RNB_YERPN Exoribonuclease 2 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rnb PE=3 SV=1 514 916 1.0E-16
sp|A9R8T9|RNB_YERPG Exoribonuclease 2 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rnb PE=3 SV=1 514 916 1.0E-16
sp|Q8ZED8|RNB_YERPE Exoribonuclease 2 OS=Yersinia pestis GN=rnb PE=3 SV=1 514 916 1.0E-16
sp|Q1C7L1|RNB_YERPA Exoribonuclease 2 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rnb PE=3 SV=1 514 916 1.0E-16
sp|Q4QJL5|RNB_HAEI8 Exoribonuclease 2 OS=Haemophilus influenzae (strain 86-028NP) GN=rnb PE=3 SV=1 513 955 4.0E-16
sp|Q46363|ZAM_SYNY3 Acetazolamide conferring resistance protein zam OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=zam PE=3 SV=1 547 966 5.0E-16
sp|Q89AM0|RNB_BUCBP Exoribonuclease 2 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rnb PE=3 SV=1 515 851 1.0E-15
sp|Q057Q9|RNB_BUCCC Exoribonuclease 2 OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=rnb PE=3 SV=1 515 840 2.0E-15
sp|A6VN85|RNB_ACTSZ Exoribonuclease 2 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rnb PE=3 SV=1 515 851 3.0E-14
sp|Q9CP74|RNB_PASMU Exoribonuclease 2 OS=Pasteurella multocida (strain Pm70) GN=rnb PE=3 SV=1 515 846 1.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0004540 ribonuclease activity Yes
GO:0140098 catalytic activity, acting on RNA No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0004518 nuclease activity No
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8753
MTSLKRSQPADPLAANISSKVYVRSTRSGKVQKIVREVYLRTDIPCSSKICKACLDGAPRNAAGQIQPPVLSDKP
AATKAFPGGHYLVPDTNALLNAMDLFEQSSCFYDVIILQTVLEELRNRSLPLYNRLVGLTKSEEKRFYVFFNDFR
LETYVNREPNESVNDRNDRAVRMAVEWYGHHLARSRAKKVPAIVMLSDDRDNVRKAREQGLSASTLVEYVRGLED
GEKLLDMVVHSQARGAGFSKPSQMLYPEYYTLSKLMTGVKAGLMHQGIFNVSPYNYLEGSIKVPAFSKPLLVLGR
ESINRAVDGDVVVVELLPQDKWKQPSTKIIEEEAITRNENADTDERGDFVSDKERKALQEEVKMTHKSSSESRPQ
PTAKVIGVVKRNWRQYVGHIDPSSASKSSNQGRKQDSVFLIPMDKKIPKIRLRTRQVSELLGKRLLVTIDAWERD
SRHPVGHLVRSLGELETKAAETEALLLEWDVQYRPFPRTVLDCLPKEGHDWKVPESSDDPGWRDREDLRGLLICS
IDPPGCQDIDDALHARKLPNGNFEVGVHIADVSNFVKPATAMDAEASVRGTTVYLVDKRIDMLPMLLGTDLCSLK
PYVERFAFSVIWELDGEADTVGVRFTKSVIKSREAFSYEQAQLRIDDESQQDELTGGMRTLLMLSKKLRQKRMEA
GALSLSSPEVKVQMESETSDPIDVKTKELLDTNSLVEEFMLLANVSVAAKIYEAFPQTAILRRHGAPPKTNFDEL
ANQLRTKKGLELRTESSKALAESLDRCVEPGEPFFNTLVRIMATRCMMSAEYFCSGTQAYPEFRHYGLASAIYTH
FTSPIRRYADLLAHRQLAAAIGYEAVHASVRSRGRLEAVCRNINARHRNAQMAGRASIAYYVGQALRGRPAADED
AFVMRIFSNGLVVLVPRFGIEGLIRLRDLAVPEPEADFDPDAYTLVTRGSRALRLELFQRVRVRVRDDKDDATGK
RGVKMELISA*
Coding >Hirsu2|8753
ATGACGAGCCTAAAGAGATCGCAGCCGGCCGACCCGCTGGCGGCGAACATCTCCAGTAAGGTCTACGTTCGCTCC
ACGCGTAGTGGCAAGGTGCAGAAAATTGTGAGGGAGGTCTATCTCAGAACCGATATCCCGTGCTCCTCCAAGATC
TGCAAGGCCTGCCTCGACGGAGCCCCCAGAAATGCGGCCGGCCAGATCCAACCGCCTGTCCTCTCGGACAAACCT
GCGGCTACCAAAGCCTTCCCTGGGGGCCATTACCTGGTCCCTGACACCAATGCGCTGCTGAACGCCATGGATCTG
TTCGAGCAAAGCTCTTGCTTCTACGACGTCATAATCCTCCAGACGGTTCTAGAAGAGCTCAGGAACCGATCCCTG
CCGCTCTACAATCGTCTGGTGGGACTGACAAAGAGTGAAGAAAAGCGCTTCTACGTATTCTTCAACGACTTTCGG
CTGGAGACGTACGTCAACCGCGAACCTAACGAGAGCGTCAATGACCGCAATGACCGTGCCGTCAGGATGGCTGTC
GAATGGTATGGCCATCATCTTGCCCGGTCGAGGGCCAAGAAGGTTCCCGCCATCGTCATGCTCAGCGATGACCGG
GACAACGTGCGCAAGGCTCGGGAGCAAGGCCTCAGCGCCTCTACTCTCGTGGAATACGTGCGGGGCCTCGAGGAC
GGCGAGAAGCTGCTCGACATGGTGGTCCACTCTCAAGCCCGAGGAGCCGGGTTCAGCAAGCCCTCGCAGATGCTG
TACCCGGAATACTACACCCTGTCCAAGTTGATGACTGGAGTCAAGGCCGGCCTGATGCACCAGGGCATATTCAAC
GTCTCTCCGTACAACTACCTGGAGGGCTCCATCAAGGTTCCCGCCTTCTCCAAGCCGCTGCTCGTGCTCGGTCGG
GAGAGCATCAACCGCGCCGTCGACGGCGACGTCGTCGTCGTCGAGCTTCTCCCGCAAGACAAGTGGAAACAACCG
TCAACGAAGATCATTGAAGAAGAGGCAATCACGCGAAACGAGAATGCGGACACGGACGAACGCGGGGACTTTGTC
TCCGACAAGGAGCGCAAGGCTCTCCAGGAAGAGGTGAAGATGACGCACAAGTCTTCTTCGGAGAGCCGACCGCAG
CCGACTGCCAAGGTCATTGGTGTCGTCAAAAGGAATTGGCGCCAGTACGTCGGTCACATCGACCCGTCCTCGGCC
AGCAAGTCTTCGAACCAGGGCCGAAAACAGGACAGCGTGTTCCTGATCCCCATGGACAAGAAGATACCCAAGATC
CGACTTCGGACCCGCCAGGTTTCGGAGCTTCTGGGGAAGCGGCTCCTCGTCACGATAGACGCATGGGAGCGCGAC
TCGAGACACCCGGTCGGACATCTCGTGCGATCGCTCGGCGAGCTCGAGACCAAGGCGGCCGAGACGGAAGCCCTG
CTCCTCGAATGGGACGTCCAGTATCGGCCGTTCCCCAGGACCGTTCTGGACTGCCTCCCGAAGGAGGGCCACGAC
TGGAAGGTGCCCGAGAGCAGCGATGATCCCGGCTGGAGGGACCGAGAAGACTTGAGGGGACTGCTCATCTGCAGC
ATCGACCCCCCCGGATGTCAGGACATCGACGACGCCCTCCACGCCAGGAAGCTTCCGAACGGCAACTTCGAGGTG
GGCGTCCACATCGCCGACGTGTCCAACTTCGTCAAGCCGGCCACGGCCATGGACGCCGAGGCCAGCGTCCGCGGC
ACGACGGTCTACCTGGTGGACAAGCGCATCGACATGCTTCCGATGCTGCTCGGCACAGACCTGTGCTCGCTCAAG
CCGTACGTCGAGCGCTTCGCCTTCTCCGTCATCTGGGAGCTCGACGGCGAGGCGGACACGGTCGGCGTGCGGTTC
ACCAAGTCGGTCATCAAGTCGCGCGAGGCGTTCAGCTACGAACAGGCCCAGCTCCGGATCGACGACGAGTCCCAG
CAGGACGAGCTGACGGGCGGGATGCGCACGCTGCTCATGCTGTCCAAGAAGCTCAGGCAGAAGCGGATGGAGGCC
GGGGCGCTGAGCCTGTCGTCGCCCGAGGTCAAGGTGCAGATGGAGTCGGAGACGTCGGACCCGATCGACGTCAAG
ACCAAGGAGCTCCTCGACACCAACTCGCTGGTGGAGGAGTTCATGCTGCTGGCCAACGTCAGCGTGGCGGCCAAG
ATCTACGAGGCCTTCCCGCAGACGGCCATCCTGCGCCGGCACGGGGCGCCGCCCAAGACCAACTTCGACGAGCTG
GCCAACCAGCTGCGGACCAAGAAGGGGCTCGAGCTGCGGACCGAGTCGAGCAAGGCGCTGGCCGAGTCGCTGGAC
CGGTGCGTCGAGCCGGGCGAGCCCTTCTTCAACACGCTGGTGCGCATCATGGCGACGCGCTGCATGATGAGCGCC
GAGTACTTCTGCTCCGGCACGCAGGCCTACCCCGAGTTCCGGCACTACGGGCTGGCGTCGGCCATCTACACGCAC
TTCACGTCGCCGATCCGCCGCTACGCCGACCTGCTGGCCCACCGGCAGCTGGCGGCCGCCATCGGCTACGAGGCG
GTGCACGCGTCGGTCCGCAGCCGCGGCCGGCTCGAGGCCGTCTGCCGCAACATCAACGCGCGCCACCGCAACGCC
CAGATGGCCGGCCGCGCCAGCATCGCCTACTACGTCGGCCAGGCGCTGCGCGGCCGCCCCGCCGCCGACGAGGAC
GCCTTCGTCATGCGCATCTTCAGCAACGGCCTCGTCGTCCTCGTCCCCCGCTTCGGCATCGAGGGCCTCATCCGC
CTGCGCGACCTGGCCGTGCCCGAGCCCGAGGCCGACTTCGACCCCGACGCCTACACCCTCGTCACCCGCGGCAGC
CGCGCCCTCCGCCTCGAGCTCTTCCAGCGCGTCCGCGTCCGCGTCCGCGACGACAAGGACGACGCCACGGGCAAG
CGCGGCGTCAAGATGGAGCTCATCAGCGCCTAG
Transcript >Hirsu2|8753
ATGACGAGCCTAAAGAGATCGCAGCCGGCCGACCCGCTGGCGGCGAACATCTCCAGTAAGGTCTACGTTCGCTCC
ACGCGTAGTGGCAAGGTGCAGAAAATTGTGAGGGAGGTCTATCTCAGAACCGATATCCCGTGCTCCTCCAAGATC
TGCAAGGCCTGCCTCGACGGAGCCCCCAGAAATGCGGCCGGCCAGATCCAACCGCCTGTCCTCTCGGACAAACCT
GCGGCTACCAAAGCCTTCCCTGGGGGCCATTACCTGGTCCCTGACACCAATGCGCTGCTGAACGCCATGGATCTG
TTCGAGCAAAGCTCTTGCTTCTACGACGTCATAATCCTCCAGACGGTTCTAGAAGAGCTCAGGAACCGATCCCTG
CCGCTCTACAATCGTCTGGTGGGACTGACAAAGAGTGAAGAAAAGCGCTTCTACGTATTCTTCAACGACTTTCGG
CTGGAGACGTACGTCAACCGCGAACCTAACGAGAGCGTCAATGACCGCAATGACCGTGCCGTCAGGATGGCTGTC
GAATGGTATGGCCATCATCTTGCCCGGTCGAGGGCCAAGAAGGTTCCCGCCATCGTCATGCTCAGCGATGACCGG
GACAACGTGCGCAAGGCTCGGGAGCAAGGCCTCAGCGCCTCTACTCTCGTGGAATACGTGCGGGGCCTCGAGGAC
GGCGAGAAGCTGCTCGACATGGTGGTCCACTCTCAAGCCCGAGGAGCCGGGTTCAGCAAGCCCTCGCAGATGCTG
TACCCGGAATACTACACCCTGTCCAAGTTGATGACTGGAGTCAAGGCCGGCCTGATGCACCAGGGCATATTCAAC
GTCTCTCCGTACAACTACCTGGAGGGCTCCATCAAGGTTCCCGCCTTCTCCAAGCCGCTGCTCGTGCTCGGTCGG
GAGAGCATCAACCGCGCCGTCGACGGCGACGTCGTCGTCGTCGAGCTTCTCCCGCAAGACAAGTGGAAACAACCG
TCAACGAAGATCATTGAAGAAGAGGCAATCACGCGAAACGAGAATGCGGACACGGACGAACGCGGGGACTTTGTC
TCCGACAAGGAGCGCAAGGCTCTCCAGGAAGAGGTGAAGATGACGCACAAGTCTTCTTCGGAGAGCCGACCGCAG
CCGACTGCCAAGGTCATTGGTGTCGTCAAAAGGAATTGGCGCCAGTACGTCGGTCACATCGACCCGTCCTCGGCC
AGCAAGTCTTCGAACCAGGGCCGAAAACAGGACAGCGTGTTCCTGATCCCCATGGACAAGAAGATACCCAAGATC
CGACTTCGGACCCGCCAGGTTTCGGAGCTTCTGGGGAAGCGGCTCCTCGTCACGATAGACGCATGGGAGCGCGAC
TCGAGACACCCGGTCGGACATCTCGTGCGATCGCTCGGCGAGCTCGAGACCAAGGCGGCCGAGACGGAAGCCCTG
CTCCTCGAATGGGACGTCCAGTATCGGCCGTTCCCCAGGACCGTTCTGGACTGCCTCCCGAAGGAGGGCCACGAC
TGGAAGGTGCCCGAGAGCAGCGATGATCCCGGCTGGAGGGACCGAGAAGACTTGAGGGGACTGCTCATCTGCAGC
ATCGACCCCCCCGGATGTCAGGACATCGACGACGCCCTCCACGCCAGGAAGCTTCCGAACGGCAACTTCGAGGTG
GGCGTCCACATCGCCGACGTGTCCAACTTCGTCAAGCCGGCCACGGCCATGGACGCCGAGGCCAGCGTCCGCGGC
ACGACGGTCTACCTGGTGGACAAGCGCATCGACATGCTTCCGATGCTGCTCGGCACAGACCTGTGCTCGCTCAAG
CCGTACGTCGAGCGCTTCGCCTTCTCCGTCATCTGGGAGCTCGACGGCGAGGCGGACACGGTCGGCGTGCGGTTC
ACCAAGTCGGTCATCAAGTCGCGCGAGGCGTTCAGCTACGAACAGGCCCAGCTCCGGATCGACGACGAGTCCCAG
CAGGACGAGCTGACGGGCGGGATGCGCACGCTGCTCATGCTGTCCAAGAAGCTCAGGCAGAAGCGGATGGAGGCC
GGGGCGCTGAGCCTGTCGTCGCCCGAGGTCAAGGTGCAGATGGAGTCGGAGACGTCGGACCCGATCGACGTCAAG
ACCAAGGAGCTCCTCGACACCAACTCGCTGGTGGAGGAGTTCATGCTGCTGGCCAACGTCAGCGTGGCGGCCAAG
ATCTACGAGGCCTTCCCGCAGACGGCCATCCTGCGCCGGCACGGGGCGCCGCCCAAGACCAACTTCGACGAGCTG
GCCAACCAGCTGCGGACCAAGAAGGGGCTCGAGCTGCGGACCGAGTCGAGCAAGGCGCTGGCCGAGTCGCTGGAC
CGGTGCGTCGAGCCGGGCGAGCCCTTCTTCAACACGCTGGTGCGCATCATGGCGACGCGCTGCATGATGAGCGCC
GAGTACTTCTGCTCCGGCACGCAGGCCTACCCCGAGTTCCGGCACTACGGGCTGGCGTCGGCCATCTACACGCAC
TTCACGTCGCCGATCCGCCGCTACGCCGACCTGCTGGCCCACCGGCAGCTGGCGGCCGCCATCGGCTACGAGGCG
GTGCACGCGTCGGTCCGCAGCCGCGGCCGGCTCGAGGCCGTCTGCCGCAACATCAACGCGCGCCACCGCAACGCC
CAGATGGCCGGCCGCGCCAGCATCGCCTACTACGTCGGCCAGGCGCTGCGCGGCCGCCCCGCCGCCGACGAGGAC
GCCTTCGTCATGCGCATCTTCAGCAACGGCCTCGTCGTCCTCGTCCCCCGCTTCGGCATCGAGGGCCTCATCCGC
CTGCGCGACCTGGCCGTGCCCGAGCCCGAGGCCGACTTCGACCCCGACGCCTACACCCTCGTCACCCGCGGCAGC
CGCGCCCTCCGCCTCGAGCTCTTCCAGCGCGTCCGCGTCCGCGTCCGCGACGACAAGGACGACGCCACGGGCAAG
CGCGGCGTCAAGATGGAGCTCATCAGCGCCTAG
Gene >Hirsu2|8753
ATGACGAGCCTAAAGAGATCGCAGCCGGCCGACCCGCTGGCGGCGAACATCTCCAGTAAGGTCTACGTTCGCTCC
ACGCGTAGTGGCAAGGTGCAGAAAATTGTGAGGGAGGTCTATCTCAGAACCGATATCCCGTGCTCCTCCAAGATC
TGCAAGGCCTGCCTCGACGGAGCCCCCAGAAATGCGGCCGGCCAGAGTACGTTGAAGCGTGCCTACGGCCGTAAC
CAGACTGACAAGATATCGGCCAGTCCAACCGCCTGTCCTCTCGGACAAACCTGCGGCTACCAAAGCCTTCCCTGG
GGGCCATTACCTGGTCCCTGACACCAATGCGCTGCTGAACGCCATGGATCTGTTCGAGCAAAGCTCTTGCTTCTA
CGACGTCATAATCCTCCAGACGGTTCTAGAAGAGCTCAGGAACCGATCCCTGCCGCTCTACAATCGTCTGGTGGG
ACTGACAAAGAGTGAAGAAAAGCGCTTCTACGTATTCTTCAACGACTTTCGGCTGGAGACGTACGTCAACCGCGA
ACCTAACGAGAGCGTCAATGACCGCAATGACCGTGCCGTCAGGATGGCTGTCGAATGGTATGGCCATCATCTTGC
CCGGTCGAGGGCCAAGAAGGTTCCCGCCATCGTCATGCTCAGCGATGACCGGGACAACGTGCGCAAGGCTCGGGA
GCAAGGCCTCAGCGCCTCTACTCTCGTGGAATACGTGCGGGGCCTCGAGGACGGCGAGAAGCTGCTCGACATGGT
GGTCCACTCTCAAGCCCGAGGAGCCGGGTTCAGCAAGCCCTCGCAGATGCTGTACCCGGAATACTACACCCTGTC
CAAGTTGATGACTGGAGTCAAGGCCGGCCTGATGCACCAGGGCATATTCAACGTCTCTCCGTACAACTACCTGGA
GGGCTCCATCAAGGTTCCCGCCTTCTCCAAGCCGCTGCTCGTGCTCGGTCGGGAGAGCATCAACCGCGCCGTCGA
CGGCGACGTCGTCGTCGTCGAGCTTCTCCCGCAAGACAAGTGGAAACAACCGTCAACGAAGATCATTGAAGAAGA
GGCAATCACGCGAAACGAGAATGCGGACACGGACGAACGCGGGGACTTTGTCTCCGACAAGGAGCGCAAGGCTCT
CCAGGAAGAGGTGAAGATGACGCACAAGTCTTCTTCGGAGAGCCGACCGCAGCCGACTGCCAAGGTCATTGGTGT
CGTCAAAAGGAATTGGCGCCAGTACGTCGGTCACATCGACCCGTCCTCGGCCAGCAAGTCTTCGAACCAGGGCCG
AAAACAGGACAGCGTGTTCCTGATCCCCATGGACAAGAAGATACCCAAGATCCGACTTCGGACCCGCCAGGTTTC
GGAGCTTCTGGGGAAGCGGCTCCTCGTCACGATAGACGCATGGGAGCGCGACTCGAGACACCCGGTCGGACATCT
CGTGCGATCGCTCGGCGAGCTCGAGACCAAGGCGGCCGAGACGGAAGCCCTGCTCCTCGAATGGGACGTCCAGTA
TCGGCCGTTCCCCAGGACCGTTCTGGACTGCCTCCCGAAGGAGGGCCACGACTGGAAGGTGCCCGAGAGCAGCGA
TGATCCCGGCTGGAGGGACCGAGAAGACTTGAGGGGACTGCTCATCTGCAGCATCGACCCCCCCGGATGTCAGGA
CATCGACGACGCCCTCCACGCCAGGAAGCTTCCGAACGGCAACTTCGAGGTGGGCGTCCACATCGCCGACGTGTC
CAACTTCGTCAAGCCGGCCACGGCCATGGACGCCGAGGCCAGCGTCCGCGGCACGACGGTCTACCTGGTGGACAA
GCGCATCGACATGCTTCCGATGCTGCTCGGCACAGACCTGTGCTCGCTCAAGCCGTACGTCGAGCGCTTCGCCTT
CTCCGTCATCTGGGAGCTCGACGGCGAGGCGGACACGGTCGGCGTGCGGTTCACCAAGTCGGTCATCAAGTCGCG
CGAGGCGTTCAGCTACGAACAGGCCCAGCTCCGGATCGACGACGAGTCCCAGCAGGACGAGCTGACGGGCGGGAT
GCGCACGCTGCTCATGCTGTCCAAGAAGCTCAGGCAGAAGCGGATGGAGGCCGGGGCGCTGAGCCTGTCGTCGCC
CGAGGTCAAGGTGCAGATGGAGTCGGAGACGTCGGACCCGATCGACGTCAAGACCAAGGAGCTCCTCGACACCAA
CTCGCTGGTGGAGGAGTTCATGCTGCTGGCCAACGTCAGCGTGGCGGCCAAGATCTACGAGGCCTTCCCGCAGAC
GGCCATCCTGCGCCGGCACGGGGCGCCGCCCAAGACCAACTTCGACGAGCTGGCCAACCAGCTGCGGACCAAGAA
GGGGCTCGAGCTGCGGACCGAGTCGAGCAAGGCGCTGGCCGAGTCGCTGGACCGGTGCGTCGAGCCGGGCGAGCC
CTTCTTCAACACGCTGGTGCGCATCATGGCGACGCGCTGCATGATGAGCGCCGAGTACTTCTGCTCCGGCACGCA
GGCCTACCCCGAGTTCCGGCACTACGGGCTGGCGTCGGCCATCTACACGCACTTCACGTCGCCGATCCGCCGCTA
CGCCGACCTGCTGGCCCACCGGCAGCTGGCGGCCGCCATCGGCTACGAGGCGGTGCACGCGTCGGTCCGCAGCCG
CGGCCGGCTCGAGGCCGTCTGCCGCAACATCAACGCGCGCCACCGCAACGCCCAGATGGCCGGCCGCGCCAGCAT
CGCCTACTACGTCGGCCAGGCGCTGCGCGGCCGCCCCGCCGCCGACGAGGACGCCTTCGTCATGCGCATCTTCAG
CAACGGCCTCGTCGTCCTCGTCCCCCGCTTCGGCATCGAGGGCCTCATCCGCCTGCGCGACCTGGCCGTGCCCGA
GCCCGAGGCCGACTTCGACCCCGACGCCTACACCCTCGTCACCCGCGGCAGCCGCGCCCTCCGCCTCGAGCTCTT
CCAGCGCGTCCGCGTCCGCGTCCGCGACGACAAGGACGACGCCACGGGCAAGCGCGGCGTCAAGATGGAGCTCAT
CAGCGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail