Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8742
Gene name
LocationContig_590:4778..6851
Strand-
Gene length (bp)2073
Transcript length (bp)1827
Coding sequence length (bp)1827
Protein length (aa) 609

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00005 ABC_tran ABC transporter 2.2E-15 102 247
PF00005 ABC_tran ABC transporter 1.2E-13 372 493
PF04068 RLI Possible Fer4-like domain in RNase L inhibitor, RLI 3.9E-12 6 37
PF00037 Fer4 4Fe-4S binding domain 8.4E-09 49 71
PF12837 Fer4_6 4Fe-4S binding domain 1.1E-05 48 70

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03195|RLI1_YEAST Translation initiation factor RLI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RLI1 PE=1 SV=1 1 603 0.0E+00
sp|O60102|RLI1_SCHPO Translation initiation factor rli1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rli1 PE=3 SV=1 1 601 0.0E+00
sp|P61222|ABCE1_MOUSE ATP-binding cassette sub-family E member 1 OS=Mus musculus GN=Abce1 PE=1 SV=1 1 602 0.0E+00
sp|P61221|ABCE1_HUMAN ATP-binding cassette sub-family E member 1 OS=Homo sapiens GN=ABCE1 PE=1 SV=1 1 602 0.0E+00
sp|Q8LPJ4|AB2E_ARATH ABC transporter E family member 2 OS=Arabidopsis thaliana GN=ABCE2 PE=2 SV=1 1 602 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03195|RLI1_YEAST Translation initiation factor RLI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RLI1 PE=1 SV=1 1 603 0.0E+00
sp|O60102|RLI1_SCHPO Translation initiation factor rli1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rli1 PE=3 SV=1 1 601 0.0E+00
sp|P61222|ABCE1_MOUSE ATP-binding cassette sub-family E member 1 OS=Mus musculus GN=Abce1 PE=1 SV=1 1 602 0.0E+00
sp|P61221|ABCE1_HUMAN ATP-binding cassette sub-family E member 1 OS=Homo sapiens GN=ABCE1 PE=1 SV=1 1 602 0.0E+00
sp|Q8LPJ4|AB2E_ARATH ABC transporter E family member 2 OS=Arabidopsis thaliana GN=ABCE2 PE=2 SV=1 1 602 0.0E+00
sp|Q9LID6|AB1E_ARATH ABC transporter E family member 1 OS=Arabidopsis thaliana GN=ABCE1 PE=2 SV=1 1 602 0.0E+00
sp|Q58129|Y719_METJA Uncharacterized ABC transporter ATP-binding protein MJ0719 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0719 PE=3 SV=1 5 602 0.0E+00
sp|Q9M0D0|AB3E_ARATH ABC transporter E family member 3 OS=Arabidopsis thaliana GN=ABCE3 PE=2 SV=1 361 524 1.0E-52
sp|Q73R11|Y282_TREDE Putative ABC transporter ATP-binding protein TDE_0282 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=TDE_0282 PE=3 SV=1 97 540 3.0E-23
sp|Q897I2|Y753_CLOTE Putative ABC transporter ATP-binding protein CTC_00753 OS=Clostridium tetani (strain Massachusetts / E88) GN=CTC_00753 PE=3 SV=1 199 541 5.0E-21
sp|Q8PUE7|Y2387_METMA Putative ABC transporter ATP-binding protein MM_2387 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_2387 PE=3 SV=1 101 565 5.0E-19
sp|Q8TQW9|Y1418_METAC Putative ABC transporter ATP-binding protein MA_1418 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1418 PE=3 SV=1 101 550 2.0E-18
sp|Q6LQ00|Y2240_PHOPR Putative ABC transporter ATP-binding protein PBPRA2240 OS=Photobacterium profundum GN=PBPRA2240 PE=3 SV=1 200 538 2.0E-17
sp|Q98DT6|SSUB1_RHILO Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Rhizobium loti (strain MAFF303099) GN=ssuB1 PE=3 SV=1 343 538 5.0E-16
sp|Q4K441|SSUB2_PSEF5 Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ssuB2 PE=3 SV=1 356 561 1.0E-15
sp|Q5FM63|ECFA1_LACAC Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=ecfA1 PE=3 SV=1 350 541 6.0E-15
sp|Q97X60|Y1893_SULSO Putative ABC transporter ATP-binding protein SSO1893 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO1893 PE=3 SV=1 103 542 7.0E-15
sp|Q92G36|ZNUC_RICCN Zinc import ATP-binding protein ZnuC OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=znuC PE=3 SV=1 356 541 1.0E-14
sp|Q0S0X2|SSUB3_RHOJR Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Rhodococcus jostii (strain RHA1) GN=ssuB3 PE=3 SV=1 371 539 1.0E-14
sp|Q57855|Y412_METJA Uncharacterized ABC transporter ATP-binding protein MJ0412 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0412 PE=3 SV=1 371 543 1.0E-14
sp|Q2J3T0|HMUV_RHOP2 Hemin import ATP-binding protein HmuV OS=Rhodopseudomonas palustris (strain HaA2) GN=hmuV PE=3 SV=1 103 293 1.0E-14
sp|Q82B58|Y5847_STRAW Putative ABC transporter ATP-binding protein SAV_5847 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=SAV_5847 PE=3 SV=1 103 538 2.0E-14
sp|Q4UJW5|ZNUC_RICFE Zinc import ATP-binding protein ZnuC OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=znuC PE=3 SV=1 356 541 2.0E-14
sp|Q9KXJ6|Y2324_STRCO Putative ABC transporter ATP-binding protein SCO2324 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO2324 PE=3 SV=1 103 541 3.0E-14
sp|Q1WSB8|ECFA1_LACS1 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus salivarius (strain UCC118) GN=ecfA1 PE=3 SV=1 374 574 3.0E-14
sp|Q8X5N2|HMUV_ECO57 Hemin import ATP-binding protein HmuV OS=Escherichia coli O157:H7 GN=hmuV PE=3 SV=3 372 580 4.0E-14
sp|Q8TIW9|Y4021_METAC Putative ABC transporter ATP-binding protein MA_4021 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_4021 PE=3 SV=1 102 292 4.0E-14
sp|O32188|YUSV_BACSU Probable siderophore transport system ATP-binding protein YusV OS=Bacillus subtilis (strain 168) GN=yusV PE=1 SV=1 375 573 8.0E-14
sp|Q8PP41|SSUB1_XANAC Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ssuB1 PE=3 SV=1 358 552 8.0E-14
sp|Q3M5J9|SSUB_ANAVT Aliphatic sulfonates import ATP-binding protein SsuB OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=ssuB PE=3 SV=1 345 539 9.0E-14
sp|Q3K506|SSUB_PSEPF Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas fluorescens (strain Pf0-1) GN=ssuB PE=3 SV=1 356 561 1.0E-13
sp|Q8FCJ1|HMUV_ECOL6 Hemin import ATP-binding protein HmuV OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hmuV PE=3 SV=2 372 580 1.0E-13
sp|Q0TBU8|HMUV_ECOL5 Hemin import ATP-binding protein HmuV OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=hmuV PE=3 SV=1 372 580 1.0E-13
sp|Q13RD3|SSUB2_BURXL Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Burkholderia xenovorans (strain LB400) GN=ssuB2 PE=3 SV=1 350 538 1.0E-13
sp|Q04EY5|ECFA1_OENOB Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=ecfA1 PE=3 SV=1 345 581 2.0E-13
sp|Q664X5|MALK_YERPS Maltose/maltodextrin import ATP-binding protein MalK OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=malK PE=3 SV=1 371 554 2.0E-13
sp|Q1CNR8|MALK_YERPN Maltose/maltodextrin import ATP-binding protein MalK OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=malK PE=3 SV=1 371 554 2.0E-13
sp|Q8ZAS8|MALK_YERPE Maltose/maltodextrin import ATP-binding protein MalK OS=Yersinia pestis GN=malK PE=3 SV=1 371 554 2.0E-13
sp|Q1CC21|MALK_YERPA Maltose/maltodextrin import ATP-binding protein MalK OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=malK PE=3 SV=1 371 554 2.0E-13
sp|Q6N7Y6|HMUV_RHOPA Hemin import ATP-binding protein HmuV OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hmuV PE=3 SV=1 103 294 2.0E-13
sp|Q97WT4|Y2030_SULSO Putative ABC transporter ATP-binding protein SSO2030 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO2030 PE=3 SV=1 103 539 2.0E-13
sp|Q138A9|HMUV_RHOPS Hemin import ATP-binding protein HmuV OS=Rhodopseudomonas palustris (strain BisB5) GN=hmuV PE=3 SV=1 102 293 2.0E-13
sp|Q8KZQ6|SSUB_PSEPU Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas putida GN=ssuB PE=1 SV=1 360 545 3.0E-13
sp|Q39CJ6|TAUB_BURL3 Taurine import ATP-binding protein TauB OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=tauB PE=3 SV=1 358 543 3.0E-13
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 356 539 3.0E-13
sp|Q5WBL0|SSUB3_BACSK Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Bacillus clausii (strain KSM-K16) GN=ssuB3 PE=3 SV=1 365 539 4.0E-13
sp|Q2K1C8|UGPC3_RHIEC sn-glycerol-3-phosphate import ATP-binding protein UgpC 3 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ugpC3 PE=3 SV=1 103 341 5.0E-13
sp|P45127|ETTA_HAEIN Energy-dependent translational throttle protein EttA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ettA PE=1 SV=1 102 541 6.0E-13
sp|Q9WXX0|RBSA1_THEMA Ribose import ATP-binding protein RbsA 1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rbsA1 PE=3 SV=1 104 541 7.0E-13
sp|Q972J5|Y1136_SULTO Putative ABC transporter ATP-binding protein STK_11360 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_11360 PE=3 SV=1 101 535 7.0E-13
sp|Q665B6|SSUB_YERPS Aliphatic sulfonates import ATP-binding protein SsuB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ssuB PE=3 SV=1 360 551 8.0E-13
sp|Q2SPI3|ZNUC1_HAHCH Zinc import ATP-binding protein ZnuC 1 OS=Hahella chejuensis (strain KCTC 2396) GN=znuC1 PE=3 SV=1 371 539 8.0E-13
sp|Q7N986|MALK_PHOLL Maltose/maltodextrin import ATP-binding protein MalK OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=malK PE=3 SV=1 348 540 1.0E-12
sp|Q6F0V4|POTA_MESFL Spermidine/putrescine import ATP-binding protein PotA OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=potA PE=3 SV=1 360 557 1.0E-12
sp|Q1RGL1|ZNUC_RICBR Zinc import ATP-binding protein ZnuC OS=Rickettsia bellii (strain RML369-C) GN=znuC PE=3 SV=1 353 541 1.0E-12
sp|Q2K6L3|UGPC1_RHIEC sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ugpC1 PE=3 SV=1 373 540 1.0E-12
sp|Q88R93|SSUB_PSEPK Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas putida (strain KT2440) GN=ssuB PE=3 SV=1 360 545 1.0E-12
sp|Q6FFZ1|SSUB_ACIAD Aliphatic sulfonates import ATP-binding protein SsuB OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ssuB PE=3 SV=1 358 539 1.0E-12
sp|Q13GD4|SSUB3_BURXL Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Burkholderia xenovorans (strain LB400) GN=ssuB3 PE=3 SV=1 350 538 1.0E-12
sp|Q73P93|Y906_TREDE Putative ABC transporter ATP-binding protein TDE_0906 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=TDE_0906 PE=3 SV=1 203 549 2.0E-12
sp|A1B9Q7|UGPC_PARDP sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Paracoccus denitrificans (strain Pd 1222) GN=ugpC PE=3 SV=1 371 539 2.0E-12
sp|Q2W4W1|ZNUC_MAGSA Zinc import ATP-binding protein ZnuC OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=znuC PE=3 SV=1 103 292 2.0E-12
sp|Q5NN23|SSUB_ZYMMO Aliphatic sulfonates import ATP-binding protein SsuB OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=ssuB PE=3 SV=1 374 551 2.0E-12
sp|O31716|YKPA_BACSU Uncharacterized ABC transporter ATP-binding protein YkpA OS=Bacillus subtilis (strain 168) GN=ykpA PE=3 SV=1 102 567 2.0E-12
sp|Q01937|LACK_RHIRD Lactose transport ATP-binding protein LacK OS=Rhizobium radiobacter GN=lacK PE=3 SV=1 371 554 2.0E-12
sp|A0KAV6|TAUB_BURCH Taurine import ATP-binding protein TauB OS=Burkholderia cenocepacia (strain HI2424) GN=tauB PE=3 SV=1 358 543 2.0E-12
sp|Q1BT84|TAUB_BURCA Taurine import ATP-binding protein TauB OS=Burkholderia cenocepacia (strain AU 1054) GN=tauB PE=3 SV=1 358 543 2.0E-12
sp|Q1CDR0|SSUB_YERPN Aliphatic sulfonates import ATP-binding protein SsuB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ssuB PE=3 SV=1 360 551 3.0E-12
sp|Q74PI5|SSUB_YERPE Aliphatic sulfonates import ATP-binding protein SsuB OS=Yersinia pestis GN=ssuB PE=3 SV=1 360 551 3.0E-12
sp|Q1C1S0|SSUB_YERPA Aliphatic sulfonates import ATP-binding protein SsuB OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ssuB PE=3 SV=1 360 551 3.0E-12
sp|Q5PDU4|CBIO_SALPA Cobalt import ATP-binding protein CbiO OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cbiO PE=3 SV=1 105 301 3.0E-12
sp|Q8Z5N5|CBIO_SALTI Cobalt import ATP-binding protein CbiO OS=Salmonella typhi GN=cbiO PE=3 SV=1 105 300 3.0E-12
sp|P07821|FHUC_ECOLI Iron(3+)-hydroxamate import ATP-binding protein FhuC OS=Escherichia coli (strain K12) GN=fhuC PE=1 SV=3 89 294 3.0E-12
sp|Q05596|CBIO_SALTY Cobalt import ATP-binding protein CbiO OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cbiO PE=1 SV=2 105 301 3.0E-12
sp|Q1M8R6|UGPC2_RHIL3 sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ugpC2 PE=3 SV=1 373 540 3.0E-12
sp|Q1LNM0|SSUB_CUPMC Aliphatic sulfonates import ATP-binding protein SsuB OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ssuB PE=3 SV=1 360 571 3.0E-12
sp|O34510|YFMF_BACSU Fe(3+)-citrate import ATP-binding protein YfmF OS=Bacillus subtilis (strain 168) GN=yfmF PE=3 SV=1 365 578 4.0E-12
sp|Q81J16|ECFA1_BACCR Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ecfA1 PE=3 SV=1 350 569 4.0E-12
sp|Q3KKA1|ZNUC_PSEPF Zinc import ATP-binding protein ZnuC OS=Pseudomonas fluorescens (strain Pf0-1) GN=znuC PE=3 SV=1 355 539 5.0E-12
sp|Q6F1W5|ECFA1_MESFL Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=ecfA1 PE=3 SV=1 371 555 5.0E-12
sp|Q0TA26|MALK_ECOL5 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=malK PE=3 SV=1 374 554 5.0E-12
sp|Q92WD6|UGPC_RHIME sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhizobium meliloti (strain 1021) GN=ugpC PE=3 SV=1 372 540 5.0E-12
sp|P40735|ECFA1_BACSU Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Bacillus subtilis (strain 168) GN=ecfA PE=3 SV=3 351 540 5.0E-12
sp|Q146E7|TAUB1_BURXL Taurine import ATP-binding protein TauB 1 OS=Burkholderia xenovorans (strain LB400) GN=tauB1 PE=3 SV=1 360 543 5.0E-12
sp|Q73F67|ECFA1_BACC1 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ecfA1 PE=3 SV=1 350 569 6.0E-12
sp|Q1B8U4|SSUB_MYCSS Aliphatic sulfonates import ATP-binding protein SsuB OS=Mycobacterium sp. (strain MCS) GN=ssuB PE=3 SV=1 371 551 6.0E-12
sp|Q1IGL4|SSUB_PSEE4 Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas entomophila (strain L48) GN=ssuB PE=3 SV=1 335 561 7.0E-12
sp|O31339|CYSA_BACC1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysA PE=3 SV=2 355 539 8.0E-12
sp|Q897I2|Y753_CLOTE Putative ABC transporter ATP-binding protein CTC_00753 OS=Clostridium tetani (strain Massachusetts / E88) GN=CTC_00753 PE=3 SV=1 91 288 9.0E-12
sp|Q81GU1|CYSA_BACCR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cysA PE=3 SV=1 355 539 9.0E-12
sp|Q8UB29|UGPC3_AGRFC sn-glycerol-3-phosphate import ATP-binding protein UgpC 3 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ugpC3 PE=3 SV=1 371 540 9.0E-12
sp|Q0BUR6|SSUB_GRABC Aliphatic sulfonates import ATP-binding protein SsuB OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=ssuB PE=3 SV=1 360 539 9.0E-12
sp|Q2K4V4|UGPC2_RHIEC sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ugpC2 PE=3 SV=1 365 540 1.0E-11
sp|Q1M589|UGPC3_RHIL3 sn-glycerol-3-phosphate import ATP-binding protein UgpC 3 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ugpC3 PE=3 SV=1 373 540 1.0E-11
sp|Q6HPN0|ECFA1_BACHK Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ecfA1 PE=3 SV=2 350 569 1.0E-11
sp|Q81VQ2|ECFA1_BACAN Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Bacillus anthracis GN=ecfA1 PE=3 SV=1 350 569 1.0E-11
sp|A0R8K8|ECFA1_BACAH Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Bacillus thuringiensis (strain Al Hakam) GN=ecfA1 PE=3 SV=2 350 569 1.0E-11
sp|Q59056|Y1662_METJA Uncharacterized ABC transporter ATP-binding protein MJ1662 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1662 PE=3 SV=2 101 403 1.0E-11
sp|Q74DN5|Y1281_GEOSL Putative ABC transporter ATP-binding protein GSU1281 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=GSU1281 PE=3 SV=1 353 538 1.0E-11
sp|Q21XJ9|SSUB_RHOFT Aliphatic sulfonates import ATP-binding protein SsuB OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=ssuB PE=3 SV=1 360 553 1.0E-11
sp|Q6CYU2|SSUB_PECAS Aliphatic sulfonates import ATP-binding protein SsuB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ssuB PE=3 SV=1 360 551 1.0E-11
sp|Q3YUV0|MALK_SHISS Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella sonnei (strain Ss046) GN=malK PE=3 SV=1 374 554 1.0E-11
sp|Q1R3Q1|MALK_ECOUT Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli (strain UTI89 / UPEC) GN=malK PE=1 SV=2 374 554 1.0E-11
sp|P68187|MALK_ECOLI Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli (strain K12) GN=malK PE=1 SV=1 374 554 1.0E-11
sp|Q8FB37|MALK_ECOL6 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=malK PE=3 SV=2 374 554 1.0E-11
sp|P68188|MALK_ECO57 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O157:H7 GN=malK PE=3 SV=1 374 554 1.0E-11
sp|P77622|DDPF_ECOLI Probable D,D-dipeptide transport ATP-binding protein DdpF OS=Escherichia coli (strain K12) GN=ddpF PE=2 SV=1 101 293 1.0E-11
sp|Q7UBD0|MALK_SHIFL Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella flexneri GN=malK PE=3 SV=1 374 554 1.0E-11
sp|Q89ER4|SSUB_BRADU Aliphatic sulfonates import ATP-binding protein SsuB OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ssuB PE=3 SV=1 360 551 1.0E-11
sp|Q46ZU5|SSUB_CUPPJ Aliphatic sulfonates import ATP-binding protein SsuB OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ssuB PE=3 SV=1 376 571 1.0E-11
sp|O57896|WTPC_PYRHO Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=wtpC PE=3 SV=1 355 535 1.0E-11
sp|Q2K1C8|UGPC3_RHIEC sn-glycerol-3-phosphate import ATP-binding protein UgpC 3 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ugpC3 PE=3 SV=1 373 540 2.0E-11
sp|O34510|YFMF_BACSU Fe(3+)-citrate import ATP-binding protein YfmF OS=Bacillus subtilis (strain 168) GN=yfmF PE=3 SV=1 103 295 2.0E-11
sp|Q63H62|ECFA1_BACCZ Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Bacillus cereus (strain ZK / E33L) GN=ecfA1 PE=3 SV=2 350 539 2.0E-11
sp|Q47MA5|HMUV_THEFY Hemin import ATP-binding protein HmuV OS=Thermobifida fusca (strain YX) GN=hmuV PE=3 SV=1 101 300 2.0E-11
sp|Q82MV1|SSUB1_STRAW Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ssuB1 PE=3 SV=1 348 539 2.0E-11
sp|Q471U2|TAUB_CUPPJ Taurine import ATP-binding protein TauB OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tauB PE=3 SV=1 360 548 2.0E-11
sp|Q881U6|SSUB2_PSESM Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ssuB2 PE=3 SV=1 375 591 2.0E-11
sp|Q0SXQ1|MALK_SHIF8 Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella flexneri serotype 5b (strain 8401) GN=malK PE=3 SV=1 374 554 2.0E-11
sp|P15031|FECE_ECOLI Fe(3+) dicitrate transport ATP-binding protein FecE OS=Escherichia coli (strain K12) GN=fecE PE=2 SV=1 103 292 2.0E-11
sp|A1B9H9|SSUB1_PARDP Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Paracoccus denitrificans (strain Pd 1222) GN=ssuB1 PE=3 SV=1 348 538 2.0E-11
sp|Q48CA0|SSUB3_PSE14 Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuB3 PE=3 SV=1 360 561 2.0E-11
sp|O68877|HMUV_PSEAE Hemin import ATP-binding protein HmuV OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=hmuV PE=3 SV=1 101 319 2.0E-11
sp|Q02FW7|HMUV_PSEAB Hemin import ATP-binding protein HmuV OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=hmuV PE=3 SV=1 101 319 2.0E-11
sp|Q1MEG2|ZNUC_RHIL3 Zinc import ATP-binding protein ZnuC OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=znuC PE=3 SV=1 375 541 2.0E-11
sp|Q5JEB0|WTPC_THEKO Molybdate/tungstate import ATP-binding protein WtpC OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=wtpC PE=3 SV=1 363 538 2.0E-11
sp|Q4UJW5|ZNUC_RICFE Zinc import ATP-binding protein ZnuC OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=znuC PE=3 SV=1 101 301 3.0E-11
sp|Q85A69|CYSA_ANTFO Sulfate/thiosulfate import ATP-binding protein CysA OS=Anthoceros formosae GN=cysA PE=2 SV=1 377 538 3.0E-11
sp|Q07LU3|HMUV_RHOP5 Hemin import ATP-binding protein HmuV OS=Rhodopseudomonas palustris (strain BisA53) GN=hmuV PE=3 SV=1 103 293 3.0E-11
sp|Q4KKK4|ZNUC_PSEF5 Zinc import ATP-binding protein ZnuC OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=znuC PE=3 SV=1 355 539 3.0E-11
sp|P10907|UGPC_ECOLI sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli (strain K12) GN=ugpC PE=1 SV=3 371 540 3.0E-11
sp|O05519|YDIF_BACSU Uncharacterized ABC transporter ATP-binding protein YdiF OS=Bacillus subtilis (strain 168) GN=ydiF PE=3 SV=2 81 536 3.0E-11
sp|Q3YW77|UGPC_SHISS sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Shigella sonnei (strain Ss046) GN=ugpC PE=3 SV=2 371 540 3.0E-11
sp|Q31VH5|UGPC_SHIBS sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Shigella boydii serotype 4 (strain Sb227) GN=ugpC PE=3 SV=2 371 540 3.0E-11
sp|Q164Y5|UGPC_ROSDO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=ugpC PE=3 SV=1 353 539 3.0E-11
sp|Q0BIZ6|UGPC_BURCM sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ugpC PE=3 SV=1 371 539 3.0E-11
sp|Q21CA3|UGPC_RHOPB sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodopseudomonas palustris (strain BisB18) GN=ugpC PE=3 SV=1 103 294 3.0E-11
sp|Q2SSS4|POTA_MYCCT Spermidine/putrescine import ATP-binding protein PotA OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=potA PE=3 SV=1 374 539 3.0E-11
sp|P54537|ARTM_BACSU Arginine transport ATP-binding protein ArtM OS=Bacillus subtilis (strain 168) GN=artM PE=1 SV=1 374 539 3.0E-11
sp|Q1GID1|UGPC_RUEST sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Ruegeria sp. (strain TM1040) GN=ugpC PE=3 SV=1 370 540 3.0E-11
sp|Q13IS7|TAUB3_BURXL Taurine import ATP-binding protein TauB 3 OS=Burkholderia xenovorans (strain LB400) GN=tauB3 PE=3 SV=1 355 543 3.0E-11
sp|Q48FT0|SSUB2_PSE14 Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuB2 PE=3 SV=1 357 561 3.0E-11
sp|Q890D1|Y100_LACPL Putative ABC transporter ATP-binding protein lp_0100 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lp_0100 PE=3 SV=2 351 552 3.0E-11
sp|Q8X6U5|UGPC_ECO57 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O157:H7 GN=ugpC PE=3 SV=2 371 540 4.0E-11
sp|Q0TC10|UGPC_ECOL5 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ugpC PE=3 SV=1 371 540 4.0E-11
sp|Q1R5H8|UGPC_ECOUT sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli (strain UTI89 / UPEC) GN=ugpC PE=3 SV=2 371 540 4.0E-11
sp|A1AGY1|UGPC_ECOK1 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O1:K1 / APEC GN=ugpC PE=3 SV=1 371 540 4.0E-11
sp|Q87UN0|ZNUC_PSESM Zinc import ATP-binding protein ZnuC OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=znuC PE=3 SV=1 357 539 4.0E-11
sp|Q8FCQ2|UGPC_ECOL6 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ugpC PE=3 SV=2 371 540 4.0E-11
sp|Q6KHL1|ECFA1_MYCMO Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=ecfA1 PE=3 SV=1 362 541 4.0E-11
sp|Q65QT6|MALK_MANSM Maltose/maltodextrin import ATP-binding protein MalK OS=Mannheimia succiniciproducens (strain MBEL55E) GN=malK PE=3 SV=1 371 554 4.0E-11
sp|Q4ZLS1|SSUB3_PSEU2 Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ssuB3 PE=3 SV=1 360 561 4.0E-11
sp|A3PRY1|UGPC_RHOS1 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ugpC PE=3 SV=1 371 539 4.0E-11
sp|O59479|Y1815_PYRHO Putative ABC transporter ATP-binding protein PH1815 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH1815 PE=3 SV=1 350 567 4.0E-11
sp|Q8PHQ3|SSUB2_XANAC Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ssuB2 PE=3 SV=1 53 312 4.0E-11
sp|Q1J982|ECFA1_STRPB Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=ecfA1 PE=3 SV=2 347 569 4.0E-11
sp|Q48QM2|ECFA1_STRPM Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=ecfA1 PE=3 SV=2 347 569 4.0E-11
sp|Q1JJC9|ECFA1_STRPC Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=ecfA1 PE=3 SV=2 347 569 4.0E-11
sp|P0C0E8|ECFA1_STRP1 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M1 GN=ecfA1 PE=3 SV=1 347 569 4.0E-11
sp|P0C0E9|ECFA_STRPY Energy-coupling factor transporter ATP-binding protein EcfA OS=Streptococcus pyogenes GN=ecfA PE=3 SV=1 347 569 4.0E-11
sp|P0CZ29|ECFA1_STRPQ Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=ecfA1 PE=3 SV=1 347 569 4.0E-11
sp|A2RH11|ECFA1_STRPG Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=ecfA1 PE=3 SV=1 347 569 4.0E-11
sp|Q1J449|ECFA1_STRPF Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=ecfA1 PE=3 SV=2 347 569 4.0E-11
sp|Q1JEC8|ECFA1_STRPD Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=ecfA1 PE=3 SV=2 347 569 4.0E-11
sp|Q7CMM7|ECFA1_STRP8 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=ecfA1 PE=3 SV=2 347 569 4.0E-11
sp|Q5X9B5|ECFA1_STRP6 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=ecfA1 PE=3 SV=2 347 569 4.0E-11
sp|P0CZ28|ECFA1_STRP3 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=ecfA1 PE=3 SV=1 347 569 4.0E-11
sp|Q48PV0|ZNUC_PSE14 Zinc import ATP-binding protein ZnuC OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=znuC PE=3 SV=1 360 539 4.0E-11
sp|Q7NRX5|UGPC_CHRVO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ugpC PE=3 SV=1 347 539 4.0E-11
sp|Q48IB9|SSUB1_PSE14 Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuB1 PE=3 SV=1 375 543 4.0E-11
sp|Q6MU19|POTA_MYCMS Spermidine/putrescine import ATP-binding protein PotA OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=potA PE=3 SV=1 374 539 5.0E-11
sp|P23878|FEPC_ECOLI Ferric enterobactin transport ATP-binding protein FepC OS=Escherichia coli (strain K12) GN=fepC PE=2 SV=2 103 301 5.0E-11
sp|Q4ZZS2|ZNUC_PSEU2 Zinc import ATP-binding protein ZnuC OS=Pseudomonas syringae pv. syringae (strain B728a) GN=znuC PE=3 SV=1 357 539 5.0E-11
sp|Q0SK28|SSUB1_RHOJR Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Rhodococcus jostii (strain RHA1) GN=ssuB1 PE=3 SV=1 360 538 5.0E-11
sp|Q13ZK7|SSUB1_BURXL Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Burkholderia xenovorans (strain LB400) GN=ssuB1 PE=3 SV=2 360 539 5.0E-11
sp|A1SWH9|UGPC_PSYIN sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Psychromonas ingrahamii (strain 37) GN=ugpC PE=3 SV=1 81 292 5.0E-11
sp|A0K3S5|UGPC_BURCH sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia cenocepacia (strain HI2424) GN=ugpC PE=3 SV=1 371 539 5.0E-11
sp|Q1BRZ8|UGPC_BURCA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia cenocepacia (strain AU 1054) GN=ugpC PE=3 SV=1 371 539 5.0E-11
sp|Q3JMW7|UGPC_BURP1 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia pseudomallei (strain 1710b) GN=ugpC PE=3 SV=1 371 539 5.0E-11
sp|Q39GT7|NODI_BURL3 Nod factor export ATP-binding protein I OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nodI PE=3 SV=2 351 559 5.0E-11
sp|Q63Q62|UGPC_BURPS sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia pseudomallei (strain K96243) GN=ugpC PE=3 SV=1 371 539 5.0E-11
sp|Q7N986|MALK_PHOLL Maltose/maltodextrin import ATP-binding protein MalK OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=malK PE=3 SV=1 103 294 6.0E-11
sp|Q1M589|UGPC3_RHIL3 sn-glycerol-3-phosphate import ATP-binding protein UgpC 3 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ugpC3 PE=3 SV=1 103 341 6.0E-11
sp|Q3IX40|UGPC_RHOS4 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ugpC PE=3 SV=1 371 539 6.0E-11
sp|A0KPH6|ZNUC_AERHH Zinc import ATP-binding protein ZnuC OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=znuC PE=3 SV=1 367 552 6.0E-11
sp|Q62GB4|UGPC_BURMA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia mallei (strain ATCC 23344) GN=ugpC PE=3 SV=1 371 539 6.0E-11
sp|Q92UI2|RBSA3_RHIME Ribose import ATP-binding protein RbsA 3 OS=Rhizobium meliloti (strain 1021) GN=rbsA3 PE=3 SV=1 101 538 6.0E-11
sp|Q8RLB6|SSUB_DELAC Aliphatic sulfonates import ATP-binding protein SsuB OS=Delftia acidovorans GN=ssuB PE=3 SV=1 348 567 6.0E-11
sp|Q2L0H5|UGPC_BORA1 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bordetella avium (strain 197N) GN=ugpC PE=3 SV=1 371 542 6.0E-11
sp|Q045Z8|ECFA1_LACGA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=ecfA1 PE=3 SV=1 341 539 6.0E-11
sp|A1WXT0|ZNUC_HALHL Zinc import ATP-binding protein ZnuC OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=znuC PE=3 SV=1 371 539 6.0E-11
sp|P19566|MALK_SALTY Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=malK PE=1 SV=3 374 554 7.0E-11
sp|Q57GZ7|MALK_SALCH Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella choleraesuis (strain SC-B67) GN=malK PE=3 SV=1 374 554 7.0E-11
sp|Q8Z1U0|MALK_SALTI Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella typhi GN=malK PE=3 SV=1 374 554 7.0E-11
sp|Q8XZQ4|SSUB_RALSO Aliphatic sulfonates import ATP-binding protein SsuB OS=Ralstonia solanacearum (strain GMI1000) GN=ssuB PE=3 SV=1 371 563 8.0E-11
sp|Q9HQ18|BTUDA_HALSA Cobalamin import ATP-binding protein BtuD OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=btuD PE=1 SV=2 374 556 8.0E-11
sp|B0R5G4|BTUDA_HALS3 Cobalamin import ATP-binding protein BtuD OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=btuD PE=3 SV=1 374 556 8.0E-11
sp|Q57554|Y089_METJA Uncharacterized ABC transporter ATP-binding protein MJ0089 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0089 PE=3 SV=1 101 309 8.0E-11
sp|Q8TQW9|Y1418_METAC Putative ABC transporter ATP-binding protein MA_1418 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1418 PE=3 SV=1 83 295 9.0E-11
sp|Q217B2|HMUV_RHOPB Hemin import ATP-binding protein HmuV OS=Rhodopseudomonas palustris (strain BisB18) GN=hmuV PE=3 SV=1 365 542 9.0E-11
sp|Q58762|WTPC_METJA Molybdate/tungstate import ATP-binding protein WtpC OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=wtpC PE=3 SV=1 92 329 9.0E-11
sp|Q9M0D0|AB3E_ARATH ABC transporter E family member 3 OS=Arabidopsis thaliana GN=ABCE3 PE=2 SV=1 104 266 1.0E-10
sp|A1SWH9|UGPC_PSYIN sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Psychromonas ingrahamii (strain 37) GN=ugpC PE=3 SV=1 352 539 1.0E-10
sp|Q8U8D6|SSUB1_AGRFC Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ssuB1 PE=3 SV=1 350 563 1.0E-10
sp|A0K739|SSUB1_BURCH Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Burkholderia cenocepacia (strain HI2424) GN=ssuB1 PE=3 SV=1 350 539 1.0E-10
sp|Q1BWL4|SSUB1_BURCA Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Burkholderia cenocepacia (strain AU 1054) GN=ssuB1 PE=3 SV=1 350 539 1.0E-10
sp|Q8DIA0|CYSA_THEEB Sulfate/thiosulfate import ATP-binding protein CysA OS=Thermosynechococcus elongatus (strain BP-1) GN=cysA PE=3 SV=1 356 539 1.0E-10
sp|Q39KB9|UGPC_BURL3 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ugpC PE=3 SV=1 371 539 1.0E-10
sp|Q6XYZ4|ECFA1_SPIKU Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Spiroplasma kunkelii GN=ecfA1 PE=3 SV=1 103 308 1.0E-10
sp|Q8ZLF4|UGPC_SALTY sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ugpC PE=1 SV=1 371 539 1.0E-10
sp|Q885N4|SSUB1_PSESM Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ssuB1 PE=3 SV=1 357 561 1.0E-10
sp|Q14Q07|POTA_SPICI Spermidine/putrescine import ATP-binding protein PotA OS=Spiroplasma citri GN=potA PE=3 SV=1 360 557 1.0E-10
sp|Q6LQ77|BTUD_PHOPR Vitamin B12 import ATP-binding protein BtuD OS=Photobacterium profundum GN=btuD PE=3 SV=1 103 297 1.0E-10
sp|Q8Z245|UGPC_SALTI sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Salmonella typhi GN=ugpC PE=3 SV=1 371 539 1.0E-10
sp|Q65P77|ECFA1_BACLD Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ecfA1 PE=3 SV=1 373 539 1.0E-10
sp|Q57IS3|UGPC_SALCH sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Salmonella choleraesuis (strain SC-B67) GN=ugpC PE=3 SV=1 371 539 1.0E-10
sp|Q9YGA6|MALK_THELN Trehalose/maltose import ATP-binding protein MalK OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) GN=malK PE=1 SV=1 103 344 1.0E-10
sp|A1JIE0|UGPC_YERE8 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ugpC PE=3 SV=1 371 539 1.0E-10
sp|P9WQI3|SUGC_MYCTU Trehalose import ATP-binding protein SugC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=sugC PE=1 SV=1 352 554 1.0E-10
sp|P9WQI2|SUGC_MYCTO Trehalose import ATP-binding protein SugC OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=sugC PE=3 SV=1 352 554 1.0E-10
sp|Q5PJL1|UGPC_SALPA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ugpC PE=3 SV=1 371 539 1.0E-10
sp|Q8U4K3|WTPC_PYRFU Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=wtpC PE=3 SV=1 355 541 1.0E-10
sp|Q1MFL8|SSUB1_RHIL3 Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ssuB1 PE=3 SV=1 350 539 1.0E-10
sp|Q5PKZ8|MALK_SALPA Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=malK PE=3 SV=1 374 554 1.0E-10
sp|Q8YDR7|Y3108_BRUME Putative ATP-binding protein BMEII0108 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=BMEII0108 PE=3 SV=2 371 543 1.0E-10
sp|P9WQL3|MODC_MYCTU Molybdenum import ATP-binding protein ModC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=modC PE=1 SV=1 366 539 1.0E-10
sp|P9WQL2|MODC_MYCTO Molybdenum import ATP-binding protein ModC OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=modC PE=3 SV=1 366 539 1.0E-10
sp|Q576E0|Y3423_BRUAB Putative ATP-binding protein BruAb2_1123 OS=Brucella abortus biovar 1 (strain 9-941) GN=BruAb2_1123 PE=3 SV=1 371 543 1.0E-10
sp|Q1QYT1|ARAG_CHRSD Arabinose import ATP-binding protein AraG OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=araG PE=3 SV=1 101 538 1.0E-10
sp|Q4FQ27|ZNUC_PSYA2 Zinc import ATP-binding protein ZnuC OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=znuC PE=3 SV=1 375 539 1.0E-10
sp|O32151|YURJ_BACSU Uncharacterized ABC transporter ATP-binding protein YurJ OS=Bacillus subtilis (strain 168) GN=yurJ PE=3 SV=1 104 327 1.0E-10
sp|Q8X5N2|HMUV_ECO57 Hemin import ATP-binding protein HmuV OS=Escherichia coli O157:H7 GN=hmuV PE=3 SV=3 103 292 2.0E-10
sp|A0KE25|RGMG3_BURCH Putative ribose/galactose/methyl galactoside import ATP-binding protein 3 OS=Burkholderia cenocepacia (strain HI2424) GN=Bcen2424_6709 PE=3 SV=1 101 496 2.0E-10
sp|Q1BGC0|RGMG3_BURCA Putative ribose/galactose/methyl galactoside import ATP-binding protein 3 OS=Burkholderia cenocepacia (strain AU 1054) GN=Bcen_6474 PE=3 SV=1 101 496 2.0E-10
sp|Q81CT8|Y2655_BACCR Putative ABC transporter ATP-binding protein BC_2655 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=BC_2655 PE=3 SV=2 220 538 2.0E-10
sp|Q8FW07|UGPC_BRUSU sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella suis biovar 1 (strain 1330) GN=ugpC PE=3 SV=1 371 539 2.0E-10
sp|Q578E9|UGPC_BRUAB sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella abortus biovar 1 (strain 9-941) GN=ugpC PE=3 SV=1 371 539 2.0E-10
sp|Q2YKR8|UGPC_BRUA2 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella abortus (strain 2308) GN=ugpC PE=3 SV=1 371 539 2.0E-10
sp|Q92N13|HMUV_RHIME Hemin import ATP-binding protein HmuV OS=Rhizobium meliloti (strain 1021) GN=hmuV PE=3 SV=1 102 292 2.0E-10
sp|Q9HYG4|SSUB1_PSEAE Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ssuB1 PE=3 SV=1 365 545 2.0E-10
sp|Q8FVT0|Y3745_BRUSU Putative ATP-binding protein BRA0745/BS1330_II0738 OS=Brucella suis biovar 1 (strain 1330) GN=BRA0745 PE=3 SV=1 366 539 2.0E-10
sp|Q13TV1|UGPC_BURXL sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia xenovorans (strain LB400) GN=ugpC PE=3 SV=1 371 539 2.0E-10
sp|Q92XW1|CYSA1_RHIME Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Rhizobium meliloti (strain 1021) GN=cysA1 PE=3 SV=1 355 538 2.0E-10
sp|Q63TW1|SSUB_BURPS Aliphatic sulfonates import ATP-binding protein SsuB OS=Burkholderia pseudomallei (strain K96243) GN=ssuB PE=3 SV=1 334 539 2.0E-10
sp|Q39GW5|SSUB1_BURL3 Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ssuB1 PE=3 SV=1 350 539 2.0E-10
sp|Q8UII7|UGPC1_AGRFC sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ugpC1 PE=3 SV=1 101 294 2.0E-10
sp|Q8UII7|UGPC1_AGRFC sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ugpC1 PE=3 SV=1 374 540 2.0E-10
sp|Q2J1U0|MODC_RHOP2 Molybdenum import ATP-binding protein ModC OS=Rhodopseudomonas palustris (strain HaA2) GN=modC PE=3 SV=1 105 292 2.0E-10
sp|Q2SU77|UGPC_BURTA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ugpC PE=3 SV=1 371 539 2.0E-10
sp|Q2YKZ7|Y2993_BRUA2 Putative ATP-binding protein BAB2_0493 OS=Brucella abortus (strain 2308) GN=BAB2_0493 PE=3 SV=1 366 539 2.0E-10
sp|Q578M5|Y2787_BRUAB Putative ATP-binding protein BruAb2_0487 OS=Brucella abortus biovar 1 (strain 9-941) GN=BruAb2_0487 PE=3 SV=1 366 539 2.0E-10
sp|Q9ZCC4|ZNUC_RICPR Zinc import ATP-binding protein ZnuC OS=Rickettsia prowazekii (strain Madrid E) GN=znuC PE=3 SV=1 375 541 2.0E-10
sp|Q4ZTG9|SSUB1_PSEU2 Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ssuB1 PE=3 SV=1 375 547 2.0E-10
sp|Q38UT9|ECFA1_LACSS Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=ecfA1 PE=3 SV=1 351 584 2.0E-10
sp|Q98G42|UGPC_RHILO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhizobium loti (strain MAFF303099) GN=ugpC PE=3 SV=1 371 540 2.0E-10
sp|Q5LX21|UGPC_RUEPO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ugpC PE=3 SV=1 369 540 2.0E-10
sp|Q3SQ65|HMUV_NITWN Hemin import ATP-binding protein HmuV OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=hmuV PE=3 SV=1 103 293 2.0E-10
sp|Q0BFQ0|SSUB_BURCM Aliphatic sulfonates import ATP-binding protein SsuB OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ssuB PE=3 SV=1 350 539 2.0E-10
sp|Q8ES39|Y804_OCEIH Putative ABC transporter ATP-binding protein OB0804 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=OB0804 PE=3 SV=1 213 542 2.0E-10
sp|Q8DRR9|ECFA1_STRMU Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=ecfA1 PE=3 SV=1 340 569 2.0E-10
sp|Q62K56|SSUB_BURMA Aliphatic sulfonates import ATP-binding protein SsuB OS=Burkholderia mallei (strain ATCC 23344) GN=ssuB PE=3 SV=2 334 539 2.0E-10
sp|Q3JSR6|SSUB_BURP1 Aliphatic sulfonates import ATP-binding protein SsuB OS=Burkholderia pseudomallei (strain 1710b) GN=ssuB PE=3 SV=1 334 539 2.0E-10
sp|Q2K6Q4|ZNUC_RHIEC Zinc import ATP-binding protein ZnuC OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=znuC PE=3 SV=1 371 541 2.0E-10
sp|Q92G36|ZNUC_RICCN Zinc import ATP-binding protein ZnuC OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=znuC PE=3 SV=1 101 301 3.0E-10
sp|P9WQI3|SUGC_MYCTU Trehalose import ATP-binding protein SugC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=sugC PE=1 SV=1 103 333 3.0E-10
sp|P9WQI2|SUGC_MYCTO Trehalose import ATP-binding protein SugC OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=sugC PE=3 SV=1 103 333 3.0E-10
sp|O70014|HMUV_SHIDY Hemin import ATP-binding protein HmuV OS=Shigella dysenteriae GN=hmuV PE=1 SV=1 103 292 3.0E-10
sp|Q32AY3|HMUV_SHIDS Hemin import ATP-binding protein HmuV OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=hmuV PE=3 SV=1 103 292 3.0E-10
sp|Q5YRK2|SSUB3_NOCFA Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Nocardia farcinica (strain IFM 10152) GN=ssuB3 PE=3 SV=1 348 555 3.0E-10
sp|Q87GB5|MALK_VIBPA Maltose/maltodextrin import ATP-binding protein MalK OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=malK PE=3 SV=1 365 554 3.0E-10
sp|Q8YDJ8|ZNUC_BRUME Zinc import ATP-binding protein ZnuC OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=znuC PE=3 SV=1 375 541 3.0E-10
sp|Q8VNL9|ECFA_ENTFC Energy-coupling factor transporter ATP-binding protein EcfA OS=Enterococcus faecium GN=ecfA PE=3 SV=1 360 538 3.0E-10
sp|Q8YCB1|UGPC_BRUME sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ugpC PE=3 SV=1 371 539 3.0E-10
sp|P16678|PHNK_ECOLI Putative phosphonates utilization ATP-binding protein PhnK OS=Escherichia coli (strain K12) GN=phnK PE=1 SV=1 73 292 3.0E-10
sp|Q81C68|SSUB_BACCR Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ssuB PE=3 SV=1 360 543 3.0E-10
sp|O34362|YKOD_BACSU Putative HMP/thiamine import ATP-binding protein YkoD OS=Bacillus subtilis (strain 168) GN=ykoD PE=1 SV=2 101 293 3.0E-10
sp|Q84EY8|HMUV_ENTCL Hemin import ATP-binding protein HmuV OS=Enterobacter cloacae GN=hmuV PE=3 SV=1 372 538 3.0E-10
sp|A1B9K8|ZNUC_PARDP Zinc import ATP-binding protein ZnuC OS=Paracoccus denitrificans (strain Pd 1222) GN=znuC PE=3 SV=1 375 541 3.0E-10
sp|P55604|Y4OS_RHISN Uncharacterized ABC transporter ATP-binding protein y4oS OS=Rhizobium sp. (strain NGR234) GN=NGR_a02170 PE=3 SV=1 83 327 3.0E-10
sp|Q8FCJ1|HMUV_ECOL6 Hemin import ATP-binding protein HmuV OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hmuV PE=3 SV=2 103 292 4.0E-10
sp|Q0TBU8|HMUV_ECOL5 Hemin import ATP-binding protein HmuV OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=hmuV PE=3 SV=1 103 292 4.0E-10
sp|Q9V2E4|Y130_PYRAB Putative ABC transporter ATP-binding protein PYRAB01300 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB01300 PE=3 SV=1 83 302 4.0E-10
sp|Q8FUN3|Y4187_BRUSU Putative ATP-binding protein BRA1187/BS1330_II1178 OS=Brucella suis biovar 1 (strain 1330) GN=BRA1187 PE=3 SV=1 371 543 4.0E-10
sp|Q2YJB5|Y3647_BRUA2 Putative ATP-binding protein BAB2_1147 OS=Brucella abortus (strain 2308) GN=BAB2_1147 PE=3 SV=1 371 543 4.0E-10
sp|Q2FRT7|ECFA2_METHJ Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=ecfA2 PE=3 SV=1 347 539 4.0E-10
sp|Q8D3S8|HMUV_VIBVU Hemin import ATP-binding protein HmuV OS=Vibrio vulnificus (strain CMCP6) GN=hmuV PE=3 SV=1 372 556 4.0E-10
sp|Q0SIB7|HMUV_RHOJR Hemin import ATP-binding protein HmuV OS=Rhodococcus jostii (strain RHA1) GN=hmuV PE=3 SV=1 101 292 4.0E-10
sp|Q9Z8J5|Y348_CHLPN Probable metal transport system ATP-binding protein CPn_0348/CP_0412/CPj0348/CpB0355 OS=Chlamydia pneumoniae GN=CPn_0348 PE=3 SV=1 103 292 4.0E-10
sp|Q2J2E9|UGPC_RHOP2 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodopseudomonas palustris (strain HaA2) GN=ugpC PE=3 SV=1 103 292 4.0E-10
sp|Q6NDQ0|UGPC_RHOPA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ugpC PE=3 SV=1 103 294 4.0E-10
sp|Q1MCN6|UGPC1_RHIL3 sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ugpC1 PE=3 SV=1 365 540 4.0E-10
sp|Q3IWB5|ZNUC_RHOS4 Zinc import ATP-binding protein ZnuC OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=znuC PE=3 SV=1 376 539 4.0E-10
sp|Q58762|WTPC_METJA Molybdate/tungstate import ATP-binding protein WtpC OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=wtpC PE=3 SV=1 374 541 5.0E-10
sp|Q74I62|Y1704_LACJO Putative ABC transporter ATP-binding protein LJ_1704 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=LJ_1704 PE=3 SV=1 202 538 5.0E-10
sp|Q66FK0|HMUV_YERPS Hemin import ATP-binding protein HmuV OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=hmuV PE=3 SV=1 103 292 5.0E-10
sp|Q1CE65|HMUV_YERPN Hemin import ATP-binding protein HmuV OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=hmuV PE=3 SV=1 103 292 5.0E-10
sp|Q56993|HMUV_YERPE Hemin import ATP-binding protein HmuV OS=Yersinia pestis GN=hmuV PE=1 SV=1 103 292 5.0E-10
sp|Q1C0Q8|HMUV_YERPA Hemin import ATP-binding protein HmuV OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=hmuV PE=3 SV=1 103 292 5.0E-10
sp|Q68Y13|ZNUC_RICTY Zinc import ATP-binding protein ZnuC OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=znuC PE=3 SV=1 375 541 5.0E-10
sp|Q02QT1|SSUB2_PSEAB Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ssuB2 PE=3 SV=1 360 545 5.0E-10
sp|Q58967|Y1572_METJA Putative ABC transporter ATP-binding protein MJ1572 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1572 PE=3 SV=1 350 541 5.0E-10
sp|Q9PKX1|Y339_CHLMU Probable metal transport system ATP-binding protein TC_0339 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=TC_0339 PE=3 SV=1 102 292 5.0E-10
sp|Q4ZQE3|SSUB2_PSEU2 Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ssuB2 PE=3 SV=1 357 540 5.0E-10
sp|Q3YUV0|MALK_SHISS Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella sonnei (strain Ss046) GN=malK PE=3 SV=1 103 292 6.0E-10
sp|Q1R3Q1|MALK_ECOUT Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli (strain UTI89 / UPEC) GN=malK PE=1 SV=2 103 292 6.0E-10
sp|P68187|MALK_ECOLI Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli (strain K12) GN=malK PE=1 SV=1 103 292 6.0E-10
sp|Q8FB37|MALK_ECOL6 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=malK PE=3 SV=2 103 292 6.0E-10
sp|P68188|MALK_ECO57 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O157:H7 GN=malK PE=3 SV=1 103 292 6.0E-10
sp|Q7UBD0|MALK_SHIFL Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella flexneri GN=malK PE=3 SV=1 103 292 6.0E-10
sp|Q8KLG1|NODI_RHIEC Nod factor export ATP-binding protein I OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=nodI PE=3 SV=3 320 561 6.0E-10
sp|Q47087|CBRD_DICD3 Achromobactin transport ATP-binding protein CbrD OS=Dickeya dadantii (strain 3937) GN=cbrD PE=3 SV=2 371 591 6.0E-10
sp|Q03ZL6|ECFA1_LEUMM Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=ecfA1 PE=1 SV=1 351 546 6.0E-10
sp|Q1Q889|ZNUC_PSYCK Zinc import ATP-binding protein ZnuC OS=Psychrobacter cryohalolentis (strain K5) GN=znuC PE=3 SV=2 375 539 6.0E-10
sp|Q5L3R0|ECFA1_GEOKA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Geobacillus kaustophilus (strain HTA426) GN=ecfA1 PE=3 SV=1 375 602 6.0E-10
sp|Q9RKQ4|HMUV_STRCO Hemin import ATP-binding protein HmuV OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=hmuV PE=3 SV=1 101 277 6.0E-10
sp|Q926D8|ZURA_LISIN Zinc uptake system ATP-binding protein ZurA OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=zurA PE=3 SV=1 357 540 6.0E-10
sp|Q1LLP5|UGPC_CUPMC sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ugpC PE=3 SV=1 371 540 6.0E-10
sp|Q1GBJ0|ECFA1_LACDA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=ecfA1 PE=3 SV=1 351 600 6.0E-10
sp|Q6D5H7|METN1_PECAS Methionine import ATP-binding protein MetN 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN1 PE=3 SV=1 103 294 6.0E-10
sp|Q9ZCC4|ZNUC_RICPR Zinc import ATP-binding protein ZnuC OS=Rickettsia prowazekii (strain Madrid E) GN=znuC PE=3 SV=1 101 308 7.0E-10
sp|P55604|Y4OS_RHISN Uncharacterized ABC transporter ATP-binding protein y4oS OS=Rhizobium sp. (strain NGR234) GN=NGR_a02170 PE=3 SV=1 363 539 7.0E-10
sp|Q28QL7|UGPC_JANSC sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Jannaschia sp. (strain CCS1) GN=ugpC PE=3 SV=1 103 292 7.0E-10
sp|Q65T42|CYSA_MANSM Sulfate/thiosulfate import ATP-binding protein CysA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=cysA PE=3 SV=1 356 539 7.0E-10
sp|Q4A5A5|ECFA1_MYCS5 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma synoviae (strain 53) GN=ecfA1 PE=3 SV=1 81 279 7.0E-10
sp|Q60AI1|POTA_METCA Spermidine/putrescine import ATP-binding protein PotA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=potA PE=3 SV=1 321 538 7.0E-10
sp|Q92LU2|MODC_RHIME Molybdenum import ATP-binding protein ModC OS=Rhizobium meliloti (strain 1021) GN=modC PE=3 SV=1 359 539 7.0E-10
sp|Q01937|LACK_RHIRD Lactose transport ATP-binding protein LacK OS=Rhizobium radiobacter GN=lacK PE=3 SV=1 204 327 8.0E-10
sp|Q576K0|ZNUC_BRUAB Zinc import ATP-binding protein ZnuC OS=Brucella abortus biovar 1 (strain 9-941) GN=znuC PE=3 SV=1 375 541 8.0E-10
sp|Q2YJH4|ZNUC_BRUA2 Zinc import ATP-binding protein ZnuC OS=Brucella abortus (strain 2308) GN=znuC PE=3 SV=1 375 541 8.0E-10
sp|A1URR2|UGPC_BARBK sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ugpC PE=3 SV=1 374 539 8.0E-10
sp|Q7MFA1|HMUV_VIBVY Hemin import ATP-binding protein HmuV OS=Vibrio vulnificus (strain YJ016) GN=hmuV PE=3 SV=1 372 556 8.0E-10
sp|Q5WKG4|SSUB1_BACSK Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Bacillus clausii (strain KSM-K16) GN=ssuB1 PE=3 SV=1 372 539 8.0E-10
sp|Q13ER6|UGPC_RHOPS sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodopseudomonas palustris (strain BisB5) GN=ugpC PE=3 SV=1 103 292 8.0E-10
sp|Q82CD3|SSUB2_STRAW Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ssuB2 PE=3 SV=1 360 551 8.0E-10
sp|P54933|SMOK_RHOSH ATP-binding transport protein SmoK OS=Rhodobacter sphaeroides GN=smoK PE=3 SV=2 362 539 8.0E-10
sp|Q0SXQ1|MALK_SHIF8 Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella flexneri serotype 5b (strain 8401) GN=malK PE=3 SV=1 103 292 9.0E-10
sp|Q9YGA6|MALK_THELN Trehalose/maltose import ATP-binding protein MalK OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) GN=malK PE=1 SV=1 371 565 9.0E-10
sp|Q4A5A5|ECFA1_MYCS5 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma synoviae (strain 53) GN=ecfA1 PE=3 SV=1 360 538 9.0E-10
sp|Q32K28|THIQ_SHIDS Thiamine import ATP-binding protein ThiQ OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=thiQ PE=3 SV=1 363 568 9.0E-10
sp|P42065|APPF_BACSU Oligopeptide transport ATP-binding protein AppF OS=Bacillus subtilis (strain 168) GN=appF PE=3 SV=2 101 293 9.0E-10
sp|Q2L0H5|UGPC_BORA1 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bordetella avium (strain 197N) GN=ugpC PE=3 SV=1 87 300 1.0E-09
sp|Q6XYZ4|ECFA1_SPIKU Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Spiroplasma kunkelii GN=ecfA1 PE=3 SV=1 371 569 1.0E-09
sp|Q8FVT0|Y3745_BRUSU Putative ATP-binding protein BRA0745/BS1330_II0738 OS=Brucella suis biovar 1 (strain 1330) GN=BRA0745 PE=3 SV=1 103 292 1.0E-09
sp|Q2YKZ7|Y2993_BRUA2 Putative ATP-binding protein BAB2_0493 OS=Brucella abortus (strain 2308) GN=BAB2_0493 PE=3 SV=1 103 292 1.0E-09
sp|Q578M5|Y2787_BRUAB Putative ATP-binding protein BruAb2_0487 OS=Brucella abortus biovar 1 (strain 9-941) GN=BruAb2_0487 PE=3 SV=1 103 292 1.0E-09
sp|Q98G42|UGPC_RHILO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhizobium loti (strain MAFF303099) GN=ugpC PE=3 SV=1 201 294 1.0E-09
sp|A1URR2|UGPC_BARBK sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ugpC PE=3 SV=1 103 292 1.0E-09
sp|Q9XDA6|ZURA_LISMO Zinc uptake system ATP-binding protein ZurA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=zurA PE=3 SV=1 357 540 1.0E-09
sp|P45094|DPPF_HAEIN Dipeptide transport ATP-binding protein DppF OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dppF PE=3 SV=1 91 293 1.0E-09
sp|Q92VJ2|CYSA2_RHIME Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Rhizobium meliloti (strain 1021) GN=cysA2 PE=3 SV=1 356 538 1.0E-09
sp|Q07LQ4|SSUB_RHOP5 Aliphatic sulfonates import ATP-binding protein SsuB OS=Rhodopseudomonas palustris (strain BisA53) GN=ssuB PE=3 SV=1 360 539 1.0E-09
sp|Q6G5J0|UGPC_BARHE sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ugpC PE=3 SV=1 374 539 1.0E-09
sp|Q5WCI1|SSUB2_BACSK Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Bacillus clausii (strain KSM-K16) GN=ssuB2 PE=3 SV=1 367 539 1.0E-09
sp|Q1BWI2|NODI_BURCA Nod factor export ATP-binding protein I OS=Burkholderia cenocepacia (strain AU 1054) GN=nodI PE=3 SV=1 375 561 1.0E-09
sp|Q8EBC3|CYSA1_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Shewanella oneidensis (strain MR-1) GN=cysA1 PE=3 SV=1 356 604 1.0E-09
sp|Q03ZQ0|POTA_LEUMM Spermidine/putrescine import ATP-binding protein PotA OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=potA PE=3 SV=1 360 554 1.0E-09
sp|Q2JLH7|PHNC2_SYNJB Phosphonates import ATP-binding protein PhnC 2 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=phnC2 PE=3 SV=1 353 542 1.0E-09
sp|Q46ZM0|UGPC_CUPPJ sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ugpC PE=3 SV=1 371 540 1.0E-09
sp|Q1IGY7|ZNUC_PSEE4 Zinc import ATP-binding protein ZnuC OS=Pseudomonas entomophila (strain L48) GN=znuC PE=3 SV=1 355 539 1.0E-09
sp|Q0TA26|MALK_ECOL5 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=malK PE=3 SV=1 103 292 2.0E-09
sp|Q1GID1|UGPC_RUEST sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Ruegeria sp. (strain TM1040) GN=ugpC PE=3 SV=1 103 294 2.0E-09
sp|Q1J982|ECFA1_STRPB Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=ecfA1 PE=3 SV=2 101 292 2.0E-09
sp|Q48QM2|ECFA1_STRPM Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=ecfA1 PE=3 SV=2 101 292 2.0E-09
sp|Q1JJC9|ECFA1_STRPC Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=ecfA1 PE=3 SV=2 101 292 2.0E-09
sp|P0C0E8|ECFA1_STRP1 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M1 GN=ecfA1 PE=3 SV=1 101 292 2.0E-09
sp|P0C0E9|ECFA_STRPY Energy-coupling factor transporter ATP-binding protein EcfA OS=Streptococcus pyogenes GN=ecfA PE=3 SV=1 101 292 2.0E-09
sp|P0CZ29|ECFA1_STRPQ Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=ecfA1 PE=3 SV=1 101 292 2.0E-09
sp|A2RH11|ECFA1_STRPG Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=ecfA1 PE=3 SV=1 101 292 2.0E-09
sp|Q1J449|ECFA1_STRPF Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=ecfA1 PE=3 SV=2 101 292 2.0E-09
sp|Q1JEC8|ECFA1_STRPD Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=ecfA1 PE=3 SV=2 101 292 2.0E-09
sp|Q7CMM7|ECFA1_STRP8 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=ecfA1 PE=3 SV=2 101 292 2.0E-09
sp|Q5X9B5|ECFA1_STRP6 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=ecfA1 PE=3 SV=2 101 292 2.0E-09
sp|P0CZ28|ECFA1_STRP3 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=ecfA1 PE=3 SV=1 101 292 2.0E-09
sp|Q1LLP5|UGPC_CUPMC sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ugpC PE=3 SV=1 103 294 2.0E-09
sp|Q28QL7|UGPC_JANSC sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Jannaschia sp. (strain CCS1) GN=ugpC PE=3 SV=1 374 539 2.0E-09
sp|Q9KAG5|RGMG_BACHD Putative ribose/galactose/methyl galactoside import ATP-binding protein OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=BH2322 PE=3 SV=1 101 553 2.0E-09
sp|Q1R597|HMUV_ECOUT Hemin import ATP-binding protein HmuV OS=Escherichia coli (strain UTI89 / UPEC) GN=hmuV PE=3 SV=2 103 292 2.0E-09
sp|Q07UI9|UGPC_RHOP5 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodopseudomonas palustris (strain BisA53) GN=ugpC PE=3 SV=1 103 294 2.0E-09
sp|Q6G194|UGPC_BARQU sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bartonella quintana (strain Toulouse) GN=ugpC PE=3 SV=1 104 292 2.0E-09
sp|Q6G194|UGPC_BARQU sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bartonella quintana (strain Toulouse) GN=ugpC PE=3 SV=1 374 539 2.0E-09
sp|Q9G4F5|CYSA_CUCSA Sulfate/thiosulfate import ATP-binding protein cysA OS=Cucumis sativus GN=CYSA PE=3 SV=1 356 540 2.0E-09
sp|Q04FM1|ECFA2_OENOB Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=ecfA2 PE=3 SV=1 352 538 2.0E-09
sp|Q9KP42|THIQ_VIBCH Thiamine import ATP-binding protein ThiQ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=thiQ PE=3 SV=2 343 535 2.0E-09
sp|P18813|MALK_ENTAE Maltose/maltodextrin import ATP-binding protein MalK (Fragment) OS=Enterobacter aerogenes GN=malK PE=3 SV=1 371 554 2.0E-09
sp|P10091|CYSA_MARPO Sulfate/thiosulfate import ATP-binding protein CysA OS=Marchantia polymorpha GN=cysA PE=3 SV=1 376 537 2.0E-09
sp|Q8RI39|POTA_FUSNN Spermidine/putrescine import ATP-binding protein PotA OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=potA PE=3 SV=1 360 540 2.0E-09
sp|Q04BY7|ECFA1_LACDB Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=ecfA1 PE=3 SV=1 351 600 2.0E-09
sp|Q57213|Y1474_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1474 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1474 PE=3 SV=1 70 293 2.0E-09
sp|Q57242|UUP1_HAEIN ABC transporter ATP-binding protein uup-1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=uup-A PE=3 SV=1 102 547 2.0E-09
sp|P10640|BEXA_HAEIF ATP-binding protein BexA OS=Haemophilus influenzae GN=bexA PE=3 SV=1 371 547 2.0E-09
sp|Q58283|Y873_METJA Uncharacterized ABC transporter ATP-binding protein MJ0873 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0873 PE=3 SV=4 103 317 2.0E-09
sp|Q50294|ECFA1_MYCPN Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ecfA1 PE=3 SV=1 374 591 2.0E-09
sp|P73265|NRTD_SYNY3 Putative nitrate transport ATP-binding protein NrtD OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=nrtD PE=3 SV=1 360 543 2.0E-09
sp|Q9V1Q4|Y373_PYRAB Putative ABC transporter ATP-binding protein PYRAB03730 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB03730 PE=3 SV=1 364 577 2.0E-09
sp|Q0S6U9|SSUB2_RHOJR Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Rhodococcus jostii (strain RHA1) GN=ssuB2 PE=3 SV=1 374 561 2.0E-09
sp|A1RG29|MACB_SHESW Macrolide export ATP-binding/permease protein MacB OS=Shewanella sp. (strain W3-18-1) GN=macB PE=3 SV=1 103 284 2.0E-09
sp|Q981Y8|SSUB2_RHILO Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Rhizobium loti (strain MAFF303099) GN=ssuB2 PE=3 SV=1 360 539 2.0E-09
sp|Q8PSR0|Y3016_METMA Putative ABC transporter ATP-binding protein MM_3016 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_3016 PE=3 SV=1 338 539 2.0E-09
sp|Q6YR39|ECFA_ONYPE Energy-coupling factor transporter ATP-binding protein EcfA OS=Onion yellows phytoplasma (strain OY-M) GN=ecfA PE=3 SV=1 374 539 2.0E-09
sp|Q89WG0|UGPC_BRADU sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ugpC PE=3 SV=1 103 294 2.0E-09
sp|Q3YSK9|ZNUC_EHRCJ Zinc import ATP-binding protein ZnuC OS=Ehrlichia canis (strain Jake) GN=znuC PE=3 SV=2 338 539 2.0E-09
sp|Q8XZX8|UGPC_RALSO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Ralstonia solanacearum (strain GMI1000) GN=ugpC PE=3 SV=1 371 540 2.0E-09
sp|Q5E6M2|ZNUC1_VIBF1 Zinc import ATP-binding protein ZnuC 1 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=znuC1 PE=3 SV=1 375 538 2.0E-09
sp|Q664X5|MALK_YERPS Maltose/maltodextrin import ATP-binding protein MalK OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=malK PE=3 SV=1 103 292 3.0E-09
sp|Q1CNR8|MALK_YERPN Maltose/maltodextrin import ATP-binding protein MalK OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=malK PE=3 SV=1 103 292 3.0E-09
sp|Q8ZAS8|MALK_YERPE Maltose/maltodextrin import ATP-binding protein MalK OS=Yersinia pestis GN=malK PE=3 SV=1 103 292 3.0E-09
sp|Q1CC21|MALK_YERPA Maltose/maltodextrin import ATP-binding protein MalK OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=malK PE=3 SV=1 103 292 3.0E-09
sp|Q2K6L3|UGPC1_RHIEC sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ugpC1 PE=3 SV=1 103 294 3.0E-09
sp|Q57554|Y089_METJA Uncharacterized ABC transporter ATP-binding protein MJ0089 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0089 PE=3 SV=1 371 565 3.0E-09
sp|Q58967|Y1572_METJA Putative ABC transporter ATP-binding protein MJ1572 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1572 PE=3 SV=1 83 281 3.0E-09
sp|Q4A8A2|ECFA1_MYCH7 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma hyopneumoniae (strain 7448) GN=ecfA1 PE=3 SV=1 372 563 3.0E-09
sp|Q601T5|ECFA1_MYCH2 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma hyopneumoniae (strain 232) GN=ecfA1 PE=3 SV=1 372 563 3.0E-09
sp|Q8UBB7|UGPC2_AGRFC sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ugpC2 PE=3 SV=2 360 539 3.0E-09
sp|Q8Z0H0|CYSA_NOSS1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cysA PE=3 SV=1 356 539 3.0E-09
sp|Q28K97|TAUB_JANSC Taurine import ATP-binding protein TauB OS=Jannaschia sp. (strain CCS1) GN=tauB PE=3 SV=1 361 595 3.0E-09
sp|Q9WXX8|Y124_THEMA Probable metal transport system ATP-binding protein TM_0124 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0124 PE=3 SV=1 330 528 3.0E-09
sp|O34946|ZNUC_BACSU High-affinity zinc uptake system ATP-binding protein ZnuC OS=Bacillus subtilis (strain 168) GN=znuC PE=1 SV=1 360 543 3.0E-09
sp|Q5ZWE4|POTA_LEGPH Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=potA PE=3 SV=2 360 539 3.0E-09
sp|Q7N3S7|HMUV_PHOLL Hemin import ATP-binding protein HmuV OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hmuV PE=3 SV=1 103 293 3.0E-09
sp|Q88AS5|CYSA_PSESM Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cysA PE=3 SV=1 352 543 3.0E-09
sp|Q9V2C0|WTPC_PYRAB Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=wtpC PE=3 SV=1 355 535 3.0E-09
sp|Q8FUU5|ZNUC_BRUSU Zinc import ATP-binding protein ZnuC OS=Brucella suis biovar 1 (strain 1330) GN=znuC PE=3 SV=1 375 541 3.0E-09
sp|Q8Y651|MNTB_LISMO Manganese transport system ATP-binding protein MntB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=mntB PE=3 SV=1 103 291 3.0E-09
sp|Q47YG8|LOLD_COLP3 Lipoprotein-releasing system ATP-binding protein LolD OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=lolD PE=3 SV=1 103 295 3.0E-09
sp|P26050|NODI_BRADU Nod factor export ATP-binding protein I OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nodI PE=3 SV=2 375 561 3.0E-09
sp|Q00752|MSMK_STRMU Multiple sugar-binding transport ATP-binding protein MsmK OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=msmK PE=3 SV=1 108 292 3.0E-09
sp|Q2SVN0|SSUB_BURTA Aliphatic sulfonates import ATP-binding protein SsuB OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ssuB PE=3 SV=1 360 539 3.0E-09
sp|Q4K5Z7|HMUV_PSEF5 Hemin import ATP-binding protein HmuV OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=hmuV PE=3 SV=1 102 294 3.0E-09
sp|Q48C94|TAUB_PSE14 Taurine import ATP-binding protein TauB OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=tauB PE=3 SV=1 376 543 3.0E-09
sp|Q6D4A8|ZNUC_PECAS Zinc import ATP-binding protein ZnuC OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=znuC PE=3 SV=1 358 539 3.0E-09
sp|Q88RA1|TAUB_PSEPK Taurine import ATP-binding protein TauB OS=Pseudomonas putida (strain KT2440) GN=tauB PE=3 SV=1 376 543 3.0E-09
sp|Q88RL1|ZNUC_PSEPK Zinc import ATP-binding protein ZnuC OS=Pseudomonas putida (strain KT2440) GN=znuC PE=3 SV=1 357 539 3.0E-09
sp|Q0T8D1|THIQ_SHIF8 Thiamine import ATP-binding protein ThiQ OS=Shigella flexneri serotype 5b (strain 8401) GN=thiQ PE=3 SV=1 363 568 3.0E-09
sp|Q3B276|LOLD2_CHLL7 Lipoprotein-releasing system ATP-binding protein LolD 2 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=lolD2 PE=3 SV=1 362 541 3.0E-09
sp|Q326G9|THIQ_SHIBS Thiamine import ATP-binding protein ThiQ OS=Shigella boydii serotype 4 (strain Sb227) GN=thiQ PE=3 SV=1 363 568 3.0E-09
sp|O57872|Y132_PYRHO Putative ABC transporter ATP-binding protein PH0132 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0132 PE=3 SV=1 106 300 3.0E-09
sp|Q8DWR3|ECFA1_STRA5 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=ecfA1 PE=3 SV=1 363 569 3.0E-09
sp|Q8E2L2|ECFA1_STRA3 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=ecfA1 PE=3 SV=1 363 569 3.0E-09
sp|Q3JYF4|ECFA1_STRA1 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=ecfA1 PE=3 SV=1 363 569 3.0E-09
sp|Q97WT4|Y2030_SULSO Putative ABC transporter ATP-binding protein SSO2030 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO2030 PE=3 SV=1 101 325 4.0E-09
sp|Q9HQ18|BTUDA_HALSA Cobalamin import ATP-binding protein BtuD OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=btuD PE=1 SV=2 101 292 4.0E-09
sp|B0R5G4|BTUDA_HALS3 Cobalamin import ATP-binding protein BtuD OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=btuD PE=3 SV=1 101 292 4.0E-09
sp|Q5LX21|UGPC_RUEPO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ugpC PE=3 SV=1 87 294 4.0E-09
sp|Q8DWR3|ECFA1_STRA5 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=ecfA1 PE=3 SV=1 70 292 4.0E-09
sp|Q8E2L2|ECFA1_STRA3 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=ecfA1 PE=3 SV=1 70 292 4.0E-09
sp|Q3JYF4|ECFA1_STRA1 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=ecfA1 PE=3 SV=1 70 292 4.0E-09
sp|Q8XA06|THIQ_ECO57 Thiamine import ATP-binding protein ThiQ OS=Escherichia coli O157:H7 GN=thiQ PE=3 SV=1 363 557 4.0E-09
sp|P48334|YCXD_CYAPA Probable ABC transporter ATP-binding protein in ycf23-apcF intergenic region OS=Cyanophora paradoxa PE=3 SV=1 75 284 4.0E-09
sp|Q97EK9|ECFA2_CLOAB Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=ecfA2 PE=3 SV=1 354 538 4.0E-09
sp|O28437|Y1841_ARCFU Putative ABC transporter ATP-binding protein AF_1841 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1841 PE=3 SV=1 103 292 4.0E-09
sp|Q03PY5|ECFA1_LACBA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=ecfA1 PE=1 SV=1 367 539 4.0E-09
sp|Q8U648|SSUB2_AGRFC Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ssuB2 PE=3 SV=2 360 539 4.0E-09
sp|Q9KD30|MNTB_BACHD Manganese transport system ATP-binding protein MntB OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mntB PE=3 SV=1 102 303 4.0E-09
sp|Q3ATY5|LOLD1_CHLCH Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Chlorobium chlorochromatii (strain CaD3) GN=lolD1 PE=3 SV=1 362 545 4.0E-09
sp|Q5WXF0|POTA_LEGPL Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila (strain Lens) GN=potA PE=3 SV=1 360 539 4.0E-09
sp|Q8FHR3|YCJV_ECOL6 Uncharacterized ABC transporter ATP-binding protein YcjV OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ycjV PE=3 SV=1 108 327 4.0E-09
sp|Q9I6L0|CYSA_PSEAE Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysA PE=3 SV=1 352 543 4.0E-09
sp|Q5YVL8|HMUV_NOCFA Hemin import ATP-binding protein HmuV OS=Nocardia farcinica (strain IFM 10152) GN=hmuV PE=3 SV=1 103 292 4.0E-09
sp|Q65M64|SSUB_BACLD Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ssuB PE=3 SV=1 360 543 4.0E-09
sp|Q0A9E2|ZNUC_ALKEH Zinc import ATP-binding protein ZnuC OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=znuC PE=3 SV=1 103 309 4.0E-09
sp|Q0TI47|YCJV_ECOL5 Uncharacterized ABC transporter ATP-binding protein YcjV OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ycjV PE=3 SV=2 108 327 4.0E-09
sp|Q1RC47|YCJV_ECOUT Uncharacterized ABC transporter ATP-binding protein YcjV OS=Escherichia coli (strain UTI89 / UPEC) GN=ycjV PE=4 SV=1 108 327 4.0E-09
sp|Q8EUF1|ECFA_MYCPE Energy-coupling factor transporter ATP-binding protein EcfA OS=Mycoplasma penetrans (strain HF-2) GN=ecfA PE=3 SV=1 108 279 4.0E-09
sp|A1TXH7|POTA_MARHV Spermidine/putrescine import ATP-binding protein PotA OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=potA PE=3 SV=1 357 538 4.0E-09
sp|Q164Y5|UGPC_ROSDO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=ugpC PE=3 SV=1 103 292 5.0E-09
sp|Q65QT6|MALK_MANSM Maltose/maltodextrin import ATP-binding protein MalK OS=Mannheimia succiniciproducens (strain MBEL55E) GN=malK PE=3 SV=1 103 292 5.0E-09
sp|Q07LQ4|SSUB_RHOP5 Aliphatic sulfonates import ATP-binding protein SsuB OS=Rhodopseudomonas palustris (strain BisA53) GN=ssuB PE=3 SV=1 74 311 5.0E-09
sp|Q57213|Y1474_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1474 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1474 PE=3 SV=1 375 536 5.0E-09
sp|Q7W9U5|CYSA_BORPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=cysA PE=3 SV=1 355 540 5.0E-09
sp|P47425|ECFA1_MYCGE Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=ecfA1 PE=3 SV=1 374 539 5.0E-09
sp|Q50801|Y583_METTM Putative ABC transporter ATP-binding protein MTBMA_c05830 OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=MTBMA_c05830 PE=3 SV=2 351 540 5.0E-09
sp|Q58488|ECFA_METJA Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ecfA PE=3 SV=1 347 541 5.0E-09
sp|Q2NVW9|THIQ_SODGM Thiamine import ATP-binding protein ThiQ OS=Sodalis glossinidius (strain morsitans) GN=thiQ PE=3 SV=1 363 540 5.0E-09
sp|Q9Z3R9|AGLK_RHIME Alpha-glucoside transport ATP-binding protein AglK OS=Rhizobium meliloti (strain 1021) GN=aglK PE=3 SV=2 101 292 5.0E-09
sp|Q6GEL4|ECFA2_STAAR Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain MRSA252) GN=ecfA2 PE=3 SV=1 371 538 5.0E-09
sp|Q8UB29|UGPC3_AGRFC sn-glycerol-3-phosphate import ATP-binding protein UgpC 3 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ugpC3 PE=3 SV=1 87 292 6.0E-09
sp|Q63Q62|UGPC_BURPS sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia pseudomallei (strain K96243) GN=ugpC PE=3 SV=1 83 278 6.0E-09
sp|Q62GB4|UGPC_BURMA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia mallei (strain ATCC 23344) GN=ugpC PE=3 SV=1 83 278 6.0E-09
sp|Q87GB5|MALK_VIBPA Maltose/maltodextrin import ATP-binding protein MalK OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=malK PE=3 SV=1 103 294 6.0E-09
sp|Q68Y13|ZNUC_RICTY Zinc import ATP-binding protein ZnuC OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=znuC PE=3 SV=1 101 308 6.0E-09
sp|Q02QT1|SSUB2_PSEAB Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ssuB2 PE=3 SV=1 103 292 6.0E-09
sp|Q7MFA1|HMUV_VIBVY Hemin import ATP-binding protein HmuV OS=Vibrio vulnificus (strain YJ016) GN=hmuV PE=3 SV=1 103 293 6.0E-09
sp|Q8XZX8|UGPC_RALSO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Ralstonia solanacearum (strain GMI1000) GN=ugpC PE=3 SV=1 103 294 6.0E-09
sp|O34756|YJKB_BACSU Putative ABC transporter ATP-binding protein YjkB OS=Bacillus subtilis (strain 168) GN=yjkB PE=3 SV=1 370 535 6.0E-09
sp|Q8E7N9|RBSA_STRA3 Ribose import ATP-binding protein RbsA OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rbsA PE=3 SV=1 83 496 6.0E-09
sp|Q3ICT8|HMUV_PSEHT Hemin import ATP-binding protein HmuV OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=hmuV PE=3 SV=1 81 301 6.0E-09
sp|Q9X051|RBSA2_THEMA Ribose import ATP-binding protein RbsA 2 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rbsA2 PE=3 SV=1 103 538 6.0E-09
sp|P45051|OPPF_HAEIN Oligopeptide transport ATP-binding protein OppF OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=oppF PE=3 SV=1 91 293 6.0E-09
sp|Q13KX9|TAUB2_BURXL Taurine import ATP-binding protein TauB 2 OS=Burkholderia xenovorans (strain LB400) GN=tauB2 PE=3 SV=1 358 547 6.0E-09
sp|Q8ZNV7|ZNUC_SALTY Zinc import ATP-binding protein ZnuC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=znuC PE=2 SV=2 102 292 6.0E-09
sp|O34512|YFMM_BACSU Uncharacterized ABC transporter ATP-binding protein YfmM OS=Bacillus subtilis (strain 168) GN=yfmM PE=3 SV=2 103 289 6.0E-09
sp|Q74DN5|Y1281_GEOSL Putative ABC transporter ATP-binding protein GSU1281 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=GSU1281 PE=3 SV=1 91 292 7.0E-09
sp|Q2SRI1|ECFA1_MYCCT Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=ecfA1 PE=3 SV=1 341 539 7.0E-09
sp|Q87FK7|ARAG_VIBPA Arabinose import ATP-binding protein AraG OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=araG PE=3 SV=1 70 552 7.0E-09
sp|Q8H1R4|AB10I_ARATH ABC transporter I family member 10, chloroplastic OS=Arabidopsis thaliana GN=ABCI10 PE=2 SV=1 376 523 7.0E-09
sp|Q6DB87|RBSA_PECAS Ribose import ATP-binding protein RbsA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rbsA PE=3 SV=1 102 538 7.0E-09
sp|P73450|NRTC_SYNY3 Nitrate transport ATP-binding protein NrtC OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=nrtC PE=3 SV=1 360 547 7.0E-09
sp|Q4AA75|ECFA1_MYCHJ Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=ecfA1 PE=3 SV=1 372 563 7.0E-09
sp|Q2GFZ6|ZNUC_EHRCR Zinc import ATP-binding protein ZnuC OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=znuC PE=3 SV=1 335 543 7.0E-09
sp|Q08381|MODC_RHOCA Molybdenum import ATP-binding protein ModC OS=Rhodobacter capsulatus GN=modC PE=3 SV=1 102 292 7.0E-09
sp|Q3JMW7|UGPC_BURP1 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia pseudomallei (strain 1710b) GN=ugpC PE=3 SV=1 83 278 8.0E-09
sp|Q8ZNV7|ZNUC_SALTY Zinc import ATP-binding protein ZnuC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=znuC PE=2 SV=2 371 539 8.0E-09
sp|Q7WGW1|CYSA_BORBR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=cysA PE=3 SV=1 355 540 8.0E-09
sp|Q9KL04|MALK_VIBCH Maltose/maltodextrin import ATP-binding protein MalK OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=malK PE=3 SV=1 371 554 8.0E-09
sp|P77481|YCJV_ECOLI Putative uncharacterized ABC transporter ATP-binding protein YcjV OS=Escherichia coli (strain K12) GN=ycjV PE=5 SV=2 108 327 8.0E-09
sp|Q8YQ88|Y3946_NOSS1 Putative ABC transporter ATP-binding protein alr3946 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3946 PE=3 SV=1 82 292 8.0E-09
sp|Q8U3E0|Y528_PYRFU Putative ABC transporter ATP-binding protein PF0528 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0528 PE=3 SV=1 362 543 8.0E-09
sp|P55476|NODI_RHISN Nod factor export ATP-binding protein I OS=Rhizobium sp. (strain NGR234) GN=nodI PE=3 SV=1 372 561 8.0E-09
sp|Q8A883|POTA_BACTN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=potA PE=3 SV=1 341 538 8.0E-09
sp|Q39KB9|UGPC_BURL3 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ugpC PE=3 SV=1 103 339 9.0E-09
sp|O34314|YTLC_BACSU Uncharacterized ABC transporter ATP-binding protein YtlC OS=Bacillus subtilis (strain 168) GN=ytlC PE=3 SV=1 376 543 9.0E-09
sp|B7VPD0|BTUD_VIBTL Vitamin B12 import ATP-binding protein BtuD OS=Vibrio tasmaniensis (strain LGP32) GN=btuD PE=3 SV=1 83 280 9.0E-09
sp|Q5PIA5|ZNUC_SALPA Zinc import ATP-binding protein ZnuC OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=znuC PE=3 SV=1 371 539 9.0E-09
sp|Q57NA5|ZNUC_SALCH Zinc import ATP-binding protein ZnuC OS=Salmonella choleraesuis (strain SC-B67) GN=znuC PE=3 SV=2 371 539 9.0E-09
sp|Q1MQ44|POTA_LAWIP Spermidine/putrescine import ATP-binding protein PotA OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=potA PE=3 SV=1 360 539 9.0E-09
sp|Q1RGL1|ZNUC_RICBR Zinc import ATP-binding protein ZnuC OS=Rickettsia bellii (strain RML369-C) GN=znuC PE=3 SV=1 101 300 1.0E-08
sp|Q1M8R6|UGPC2_RHIL3 sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ugpC2 PE=3 SV=1 69 294 1.0E-08
sp|Q2K4V4|UGPC2_RHIEC sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ugpC2 PE=3 SV=1 202 354 1.0E-08
sp|Q9XDA6|ZURA_LISMO Zinc uptake system ATP-binding protein ZurA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=zurA PE=3 SV=1 103 291 1.0E-08
sp|Q46ZM0|UGPC_CUPPJ sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ugpC PE=3 SV=1 103 294 1.0E-08
sp|P47425|ECFA1_MYCGE Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=ecfA1 PE=3 SV=1 91 279 1.0E-08
sp|Q2KBP5|BIOM_RHIEC Biotin transport ATP-binding protein BioM OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=bioM PE=1 SV=1 378 538 1.0E-08
sp|Q83MG3|THIQ_SHIFL Thiamine import ATP-binding protein ThiQ OS=Shigella flexneri GN=thiQ PE=3 SV=4 363 557 1.0E-08
sp|Q92AF9|MNTB_LISIN Manganese transport system ATP-binding protein MntB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=mntB PE=3 SV=1 103 291 1.0E-08
sp|Q8Z5W6|ZNUC_SALTI Zinc import ATP-binding protein ZnuC OS=Salmonella typhi GN=znuC PE=3 SV=1 371 539 1.0E-08
sp|Q87J32|HMUV_VIBPA Hemin import ATP-binding protein HmuV OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=hmuV PE=3 SV=2 101 293 1.0E-08
sp|Q7MPC5|THIQ_VIBVY Thiamine import ATP-binding protein ThiQ OS=Vibrio vulnificus (strain YJ016) GN=thiQ PE=3 SV=1 357 539 1.0E-08
sp|Q8DE95|THIQ_VIBVU Thiamine import ATP-binding protein ThiQ OS=Vibrio vulnificus (strain CMCP6) GN=thiQ PE=3 SV=1 357 539 1.0E-08
sp|Q3Z5U5|THIQ_SHISS Thiamine import ATP-binding protein ThiQ OS=Shigella sonnei (strain Ss046) GN=thiQ PE=3 SV=1 363 568 1.0E-08
sp|Q3K3R2|RBSA_STRA1 Ribose import ATP-binding protein RbsA OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rbsA PE=3 SV=1 83 496 1.0E-08
sp|P44662|Y361_HAEIN Probable iron transport system ATP-binding protein HI_0361 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0361 PE=3 SV=1 81 291 1.0E-08
sp|P63396|Y1312_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1312c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1312c PE=3 SV=1 102 321 1.0E-08
sp|P9WQJ5|Y1281_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1281c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1281c PE=1 SV=1 102 321 1.0E-08
sp|P9WQJ4|Y1281_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1318 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1318 PE=3 SV=1 102 321 1.0E-08
sp|Q8KZR4|TAUB_PSEPU Taurine import ATP-binding protein TauB OS=Pseudomonas putida GN=tauB PE=3 SV=1 376 543 1.0E-08
sp|C0SP98|YKFD_BACSU Putative oligopeptide transport ATP-binding protein YkfD OS=Bacillus subtilis (strain 168) GN=ykfD PE=3 SV=1 101 293 1.0E-08
sp|Q7MLB8|UGPC_VIBVY sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Vibrio vulnificus (strain YJ016) GN=ugpC PE=3 SV=2 353 538 1.0E-08
sp|Q032H3|ECFA2_LACLS Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=ecfA2 PE=3 SV=1 352 534 1.0E-08
sp|Q7N6Z2|CYSA_PHOLL Sulfate/thiosulfate import ATP-binding protein CysA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysA PE=3 SV=1 374 537 1.0E-08
sp|Q8D954|UGPC_VIBVU sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Vibrio vulnificus (strain CMCP6) GN=ugpC PE=3 SV=1 353 538 1.0E-08
sp|Q8RCU0|PSTB1_CALS4 Phosphate import ATP-binding protein PstB 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pstB1 PE=3 SV=1 108 320 1.0E-08
sp|Q5PB72|ZNUC_ANAMM Zinc import ATP-binding protein ZnuC OS=Anaplasma marginale (strain St. Maries) GN=znuC PE=3 SV=1 376 539 1.0E-08
sp|Q8X8K4|YCJV_ECO57 Uncharacterized ABC transporter ATP-binding protein YcjV OS=Escherichia coli O157:H7 GN=ycjV PE=3 SV=1 108 327 1.0E-08
sp|Q9KUI0|CYSA_VIBCH Sulfate/thiosulfate import ATP-binding protein CysA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysA PE=3 SV=1 103 292 1.0E-08
sp|Q0I3Y9|POTA_HAES1 Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus somnus (strain 129Pt) GN=potA PE=3 SV=1 360 539 1.0E-08
sp|P55453|Y4FO_RHISN Uncharacterized ABC transporter ATP-binding protein y4fO OS=Rhizobium sp. (strain NGR234) GN=NGR_a03670 PE=3 SV=1 371 539 1.0E-08
sp|Q839D5|ECFA1_ENTFA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=ecfA1 PE=3 SV=1 351 569 1.0E-08
sp|P23888|KPST1_ECOLX Polysialic acid transport ATP-binding protein KpsT OS=Escherichia coli GN=kpsT PE=1 SV=1 378 498 1.0E-08
sp|Q3K6R9|HMUV_PSEPF Hemin import ATP-binding protein HmuV OS=Pseudomonas fluorescens (strain Pf0-1) GN=hmuV PE=3 SV=1 102 294 1.0E-08
sp|Q8FFB3|CYSA_ECOL6 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysA PE=3 SV=1 356 538 1.0E-08
sp|Q8RBQ1|RGMG_CALS4 Putative ribose/galactose/methyl galactoside import ATP-binding protein OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE0763 PE=3 SV=1 101 538 1.0E-08
sp|Q6G4Q8|Y276_BARHE Putative ABC transporter ATP-binding protein BH02760 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=BH02760 PE=3 SV=1 81 282 1.0E-08
sp|Q6G4Q8|Y276_BARHE Putative ABC transporter ATP-binding protein BH02760 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=BH02760 PE=3 SV=1 378 545 1.0E-08
sp|Q9KLL9|MODC_VIBCH Molybdenum import ATP-binding protein ModC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=modC PE=3 SV=1 356 539 1.0E-08
sp|Q0VTB6|ZNUC_ALCBS Zinc import ATP-binding protein ZnuC OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=znuC PE=3 SV=1 102 292 1.0E-08
sp|Q6N7Y6|HMUV_RHOPA Hemin import ATP-binding protein HmuV OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hmuV PE=3 SV=1 372 540 2.0E-08
sp|Q138A9|HMUV_RHOPS Hemin import ATP-binding protein HmuV OS=Rhodopseudomonas palustris (strain BisB5) GN=hmuV PE=3 SV=1 348 575 2.0E-08
sp|Q88R93|SSUB_PSEPK Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas putida (strain KT2440) GN=ssuB PE=3 SV=1 103 292 2.0E-08
sp|Q73P93|Y906_TREDE Putative ABC transporter ATP-binding protein TDE_0906 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=TDE_0906 PE=3 SV=1 376 539 2.0E-08
sp|Q07LU3|HMUV_RHOP5 Hemin import ATP-binding protein HmuV OS=Rhodopseudomonas palustris (strain BisA53) GN=hmuV PE=3 SV=1 363 538 2.0E-08
sp|P19566|MALK_SALTY Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=malK PE=1 SV=3 103 292 2.0E-08
sp|Q57GZ7|MALK_SALCH Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella choleraesuis (strain SC-B67) GN=malK PE=3 SV=1 103 292 2.0E-08
sp|Q8Z1U0|MALK_SALTI Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella typhi GN=malK PE=3 SV=1 103 292 2.0E-08
sp|Q9HYG4|SSUB1_PSEAE Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ssuB1 PE=3 SV=1 103 292 2.0E-08
sp|Q2SU77|UGPC_BURTA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ugpC PE=3 SV=1 103 278 2.0E-08
sp|Q8D3S8|HMUV_VIBVU Hemin import ATP-binding protein HmuV OS=Vibrio vulnificus (strain CMCP6) GN=hmuV PE=3 SV=1 103 293 2.0E-08
sp|Q1IGY7|ZNUC_PSEE4 Zinc import ATP-binding protein ZnuC OS=Pseudomonas entomophila (strain L48) GN=znuC PE=3 SV=1 102 292 2.0E-08
sp|Q5E6M2|ZNUC1_VIBF1 Zinc import ATP-binding protein ZnuC 1 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=znuC1 PE=3 SV=1 104 292 2.0E-08
sp|Q8Y651|MNTB_LISMO Manganese transport system ATP-binding protein MntB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=mntB PE=3 SV=1 365 537 2.0E-08
sp|Q5YVL8|HMUV_NOCFA Hemin import ATP-binding protein HmuV OS=Nocardia farcinica (strain IFM 10152) GN=hmuV PE=3 SV=1 356 556 2.0E-08
sp|Q8EUF1|ECFA_MYCPE Energy-coupling factor transporter ATP-binding protein EcfA OS=Mycoplasma penetrans (strain HF-2) GN=ecfA PE=3 SV=1 374 597 2.0E-08
sp|Q7UC29|CYSA_SHIFL Sulfate/thiosulfate import ATP-binding protein CysA OS=Shigella flexneri GN=cysA PE=3 SV=1 356 538 2.0E-08
sp|P94360|MSMX_BACSU Maltodextrin import ATP-binding protein MsmX OS=Bacillus subtilis (strain 168) GN=msmX PE=3 SV=1 108 333 2.0E-08
sp|Q8UF79|ZNUC_AGRFC Zinc import ATP-binding protein ZnuC OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=znuC PE=3 SV=1 371 541 2.0E-08
sp|Q04G50|POTA_OENOB Spermidine/putrescine import ATP-binding protein PotA OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=potA PE=3 SV=2 358 539 2.0E-08
sp|Q7VZE5|CYSA_BORPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cysA PE=3 SV=1 355 540 2.0E-08
sp|P16676|CYSA_ECOLI Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli (strain K12) GN=cysA PE=3 SV=2 356 538 2.0E-08
sp|P49938|FHUC_BACSU Iron(3+)-hydroxamate import ATP-binding protein FhuC OS=Bacillus subtilis (strain 168) GN=fhuC PE=3 SV=1 103 292 2.0E-08
sp|Q5DZC6|MALK_VIBF1 Maltose/maltodextrin import ATP-binding protein MalK OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=malK PE=3 SV=1 365 540 2.0E-08
sp|Q6LR20|POTA_PHOPR Spermidine/putrescine import ATP-binding protein PotA OS=Photobacterium profundum GN=potA PE=3 SV=1 373 542 2.0E-08
sp|Q8Z4V6|CYSA_SALTI Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhi GN=cysA PE=3 SV=1 356 538 2.0E-08
sp|Q8PC11|CYSA_XANCP Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cysA PE=3 SV=1 375 539 2.0E-08
sp|Q8XBJ8|CYSA_ECO57 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O157:H7 GN=cysA PE=3 SV=1 356 538 2.0E-08
sp|Q92CV8|TAGH_LISIN Teichoic acids export ATP-binding protein TagH OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=tagH PE=3 SV=1 346 582 2.0E-08
sp|Q28VN1|ZNUC_JANSC Zinc import ATP-binding protein ZnuC OS=Jannaschia sp. (strain CCS1) GN=znuC PE=3 SV=1 375 541 2.0E-08
sp|Q6HI76|Y2424_BACHK Putative ABC transporter ATP-binding protein BT9727_2424 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=BT9727_2424 PE=3 SV=1 220 555 2.0E-08
sp|O52618|NODI_RHIME Nod factor export ATP-binding protein I OS=Rhizobium meliloti (strain 1021) GN=nodI PE=3 SV=3 375 561 2.0E-08
sp|A2RI02|ECFA2_LACLM Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=ecfA2 PE=1 SV=1 352 523 2.0E-08
sp|Q63A38|SSUB_BACCZ Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus cereus (strain ZK / E33L) GN=ssuB PE=3 SV=1 360 543 2.0E-08
sp|P37313|DPPF_ECOLI Dipeptide transport ATP-binding protein DppF OS=Escherichia coli (strain K12) GN=dppF PE=3 SV=1 91 293 2.0E-08
sp|Q1CJG3|ZNUC_YERPN Zinc import ATP-binding protein ZnuC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=znuC PE=3 SV=1 375 539 2.0E-08
sp|Q7CIC2|ZNUC_YERPE Zinc import ATP-binding protein ZnuC OS=Yersinia pestis GN=znuC PE=3 SV=1 375 539 2.0E-08
sp|Q1C812|ZNUC_YERPA Zinc import ATP-binding protein ZnuC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=znuC PE=3 SV=1 375 539 2.0E-08
sp|Q8KFD6|Y391_CHLTE Putative ABC transporter ATP-binding protein CT0391 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT0391 PE=3 SV=1 101 292 2.0E-08
sp|Q7WID6|UGPC_BORBR sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ugpC PE=3 SV=1 103 300 2.0E-08
sp|Q8E281|RBSA_STRA5 Ribose import ATP-binding protein RbsA OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rbsA PE=3 SV=1 83 496 2.0E-08
sp|Q66AT7|ZNUC_YERPS Zinc import ATP-binding protein ZnuC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=znuC PE=3 SV=1 375 539 2.0E-08
sp|Q7MFC4|MALK_VIBVY Maltose/maltodextrin import ATP-binding protein MalK OS=Vibrio vulnificus (strain YJ016) GN=malK PE=3 SV=1 371 554 2.0E-08
sp|Q8D3V0|MALK_VIBVU Maltose/maltodextrin import ATP-binding protein MalK OS=Vibrio vulnificus (strain CMCP6) GN=malK PE=3 SV=1 371 554 2.0E-08
sp|Q7W6G5|UGPC_BORPA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ugpC PE=3 SV=1 103 300 2.0E-08
sp|Q4QK57|POTA_HAEI8 Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus influenzae (strain 86-028NP) GN=potA PE=3 SV=2 360 542 2.0E-08
sp|P40860|CYSA_SALTY Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysA PE=3 SV=2 356 538 2.0E-08
sp|Q7VYN2|UGPC_BORPE sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ugpC PE=3 SV=1 103 300 2.0E-08
sp|O84071|Y068_CHLTR Probable metal transport system ATP-binding protein CT_068 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=CT_068 PE=3 SV=1 102 292 2.0E-08
sp|Q4L8L7|HRTA_STAHJ Putative hemin import ATP-binding protein HrtA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=hrtA PE=3 SV=1 352 541 2.0E-08
sp|P45171|POTA_HAEIN Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=potA PE=3 SV=2 360 542 2.0E-08
sp|Q0BIZ6|UGPC_BURCM sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ugpC PE=3 SV=1 103 339 3.0E-08
sp|A0K3S5|UGPC_BURCH sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia cenocepacia (strain HI2424) GN=ugpC PE=3 SV=1 103 339 3.0E-08
sp|Q1BRZ8|UGPC_BURCA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia cenocepacia (strain AU 1054) GN=ugpC PE=3 SV=1 103 339 3.0E-08
sp|Q5PKZ8|MALK_SALPA Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=malK PE=3 SV=1 103 292 3.0E-08
sp|Q1MCN6|UGPC1_RHIL3 sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ugpC1 PE=3 SV=1 202 354 3.0E-08
sp|Q926D8|ZURA_LISIN Zinc uptake system ATP-binding protein ZurA OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=zurA PE=3 SV=1 103 291 3.0E-08
sp|Q6G5J0|UGPC_BARHE sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ugpC PE=3 SV=1 104 292 3.0E-08
sp|Q88RL1|ZNUC_PSEPK Zinc import ATP-binding protein ZnuC OS=Pseudomonas putida (strain KT2440) GN=znuC PE=3 SV=1 102 292 3.0E-08
sp|P55453|Y4FO_RHISN Uncharacterized ABC transporter ATP-binding protein y4fO OS=Rhizobium sp. (strain NGR234) GN=NGR_a03670 PE=3 SV=1 103 292 3.0E-08
sp|Q8EBC3|CYSA1_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Shewanella oneidensis (strain MR-1) GN=cysA1 PE=3 SV=1 103 292 4.0E-08
sp|Q9KL04|MALK_VIBCH Maltose/maltodextrin import ATP-binding protein MalK OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=malK PE=3 SV=1 101 292 4.0E-08
sp|P94360|MSMX_BACSU Maltodextrin import ATP-binding protein MsmX OS=Bacillus subtilis (strain 168) GN=msmX PE=3 SV=1 353 541 4.0E-08
sp|Q4L8L7|HRTA_STAHJ Putative hemin import ATP-binding protein HrtA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=hrtA PE=3 SV=1 103 295 4.0E-08
sp|Q89ER4|SSUB_BRADU Aliphatic sulfonates import ATP-binding protein SsuB OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ssuB PE=3 SV=1 103 318 5.0E-08
sp|O32151|YURJ_BACSU Uncharacterized ABC transporter ATP-binding protein YurJ OS=Bacillus subtilis (strain 168) GN=yurJ PE=3 SV=1 374 539 5.0E-08
sp|Q8ES39|Y804_OCEIH Putative ABC transporter ATP-binding protein OB0804 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=OB0804 PE=3 SV=1 374 564 5.0E-08
sp|Q2K6Q4|ZNUC_RHIEC Zinc import ATP-binding protein ZnuC OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=znuC PE=3 SV=1 103 300 5.0E-08
sp|Q50294|ECFA1_MYCPN Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ecfA1 PE=3 SV=1 78 279 5.0E-08
sp|Q0A9E2|ZNUC_ALKEH Zinc import ATP-binding protein ZnuC OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=znuC PE=3 SV=1 374 539 5.0E-08
sp|Q8KZQ6|SSUB_PSEPU Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas putida GN=ssuB PE=1 SV=1 103 292 7.0E-08
sp|Q07UI9|UGPC_RHOP5 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodopseudomonas palustris (strain BisA53) GN=ugpC PE=3 SV=1 374 540 7.0E-08
sp|Q00752|MSMK_STRMU Multiple sugar-binding transport ATP-binding protein MsmK OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=msmK PE=3 SV=1 374 538 7.0E-08
sp|Q03ZQ0|POTA_LEUMM Spermidine/putrescine import ATP-binding protein PotA OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=potA PE=3 SV=1 81 292 8.0E-08
sp|Q5WXF0|POTA_LEGPL Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila (strain Lens) GN=potA PE=3 SV=1 103 292 8.0E-08
sp|Q5JEB0|WTPC_THEKO Molybdate/tungstate import ATP-binding protein WtpC OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=wtpC PE=3 SV=1 103 255 9.0E-08
sp|Q8DIA0|CYSA_THEEB Sulfate/thiosulfate import ATP-binding protein CysA OS=Thermosynechococcus elongatus (strain BP-1) GN=cysA PE=3 SV=1 103 292 9.0E-08
sp|Q8PUE7|Y2387_METMA Putative ABC transporter ATP-binding protein MM_2387 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_2387 PE=3 SV=1 61 282 1.0E-07
sp|Q8TIW9|Y4021_METAC Putative ABC transporter ATP-binding protein MA_4021 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_4021 PE=3 SV=1 347 538 1.0E-07
sp|A1B9Q7|UGPC_PARDP sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Paracoccus denitrificans (strain Pd 1222) GN=ugpC PE=3 SV=1 79 292 1.0E-07
sp|Q48CA0|SSUB3_PSE14 Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuB3 PE=3 SV=1 103 305 1.0E-07
sp|Q13ER6|UGPC_RHOPS sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodopseudomonas palustris (strain BisB5) GN=ugpC PE=3 SV=1 371 539 1.0E-07
sp|Q1RC47|YCJV_ECOUT Uncharacterized ABC transporter ATP-binding protein YcjV OS=Escherichia coli (strain UTI89 / UPEC) GN=ycjV PE=4 SV=1 371 554 1.0E-07
sp|Q2KBP5|BIOM_RHIEC Biotin transport ATP-binding protein BioM OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=bioM PE=1 SV=1 94 282 1.0E-07
sp|Q92AF9|MNTB_LISIN Manganese transport system ATP-binding protein MntB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=mntB PE=3 SV=1 365 537 1.0E-07
sp|Q5DZC6|MALK_VIBF1 Maltose/maltodextrin import ATP-binding protein MalK OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=malK PE=3 SV=1 103 294 1.0E-07
sp|Q7MFC4|MALK_VIBVY Maltose/maltodextrin import ATP-binding protein MalK OS=Vibrio vulnificus (strain YJ016) GN=malK PE=3 SV=1 103 294 1.0E-07
sp|Q8D3V0|MALK_VIBVU Maltose/maltodextrin import ATP-binding protein MalK OS=Vibrio vulnificus (strain CMCP6) GN=malK PE=3 SV=1 103 294 1.0E-07
sp|Q8PUE7|Y2387_METMA Putative ABC transporter ATP-binding protein MM_2387 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_2387 PE=3 SV=1 350 539 2.0E-07
sp|Q5WBL0|SSUB3_BACSK Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Bacillus clausii (strain KSM-K16) GN=ssuB3 PE=3 SV=1 103 292 2.0E-07
sp|Q665B6|SSUB_YERPS Aliphatic sulfonates import ATP-binding protein SsuB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ssuB PE=3 SV=1 76 311 2.0E-07
sp|Q1CDR0|SSUB_YERPN Aliphatic sulfonates import ATP-binding protein SsuB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ssuB PE=3 SV=1 76 311 2.0E-07
sp|Q74PI5|SSUB_YERPE Aliphatic sulfonates import ATP-binding protein SsuB OS=Yersinia pestis GN=ssuB PE=3 SV=1 76 311 2.0E-07
sp|Q1C1S0|SSUB_YERPA Aliphatic sulfonates import ATP-binding protein SsuB OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ssuB PE=3 SV=1 76 311 2.0E-07
sp|Q1IGL4|SSUB_PSEE4 Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas entomophila (strain L48) GN=ssuB PE=3 SV=1 103 292 2.0E-07
sp|P77622|DDPF_ECOLI Probable D,D-dipeptide transport ATP-binding protein DdpF OS=Escherichia coli (strain K12) GN=ddpF PE=2 SV=1 351 538 2.0E-07
sp|Q21CA3|UGPC_RHOPB sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodopseudomonas palustris (strain BisB18) GN=ugpC PE=3 SV=1 374 540 2.0E-07
sp|Q6KHL1|ECFA1_MYCMO Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=ecfA1 PE=3 SV=1 73 292 2.0E-07
sp|Q4ZLS1|SSUB3_PSEU2 Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ssuB3 PE=3 SV=1 103 305 2.0E-07
sp|Q6LQ77|BTUD_PHOPR Vitamin B12 import ATP-binding protein BtuD OS=Photobacterium profundum GN=btuD PE=3 SV=1 355 539 2.0E-07
sp|Q1MFL8|SSUB1_RHIL3 Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ssuB1 PE=3 SV=1 103 292 2.0E-07
sp|Q8YDJ8|ZNUC_BRUME Zinc import ATP-binding protein ZnuC OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=znuC PE=3 SV=1 103 309 2.0E-07
sp|Q9V2E4|Y130_PYRAB Putative ABC transporter ATP-binding protein PYRAB01300 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB01300 PE=3 SV=1 347 541 2.0E-07
sp|Q576K0|ZNUC_BRUAB Zinc import ATP-binding protein ZnuC OS=Brucella abortus biovar 1 (strain 9-941) GN=znuC PE=3 SV=1 103 309 2.0E-07
sp|Q2YJH4|ZNUC_BRUA2 Zinc import ATP-binding protein ZnuC OS=Brucella abortus (strain 2308) GN=znuC PE=3 SV=1 103 309 2.0E-07
sp|Q8FHR3|YCJV_ECOL6 Uncharacterized ABC transporter ATP-binding protein YcjV OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ycjV PE=3 SV=1 371 554 2.0E-07
sp|Q0TI47|YCJV_ECOL5 Uncharacterized ABC transporter ATP-binding protein YcjV OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ycjV PE=3 SV=2 371 554 2.0E-07
sp|P77481|YCJV_ECOLI Putative uncharacterized ABC transporter ATP-binding protein YcjV OS=Escherichia coli (strain K12) GN=ycjV PE=5 SV=2 371 554 2.0E-07
sp|Q8X8K4|YCJV_ECO57 Uncharacterized ABC transporter ATP-binding protein YcjV OS=Escherichia coli O157:H7 GN=ycjV PE=3 SV=1 371 554 2.0E-07
sp|Q8KFD6|Y391_CHLTE Putative ABC transporter ATP-binding protein CT0391 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT0391 PE=3 SV=1 353 541 2.0E-07
sp|Q97X60|Y1893_SULSO Putative ABC transporter ATP-binding protein SSO1893 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO1893 PE=3 SV=1 101 325 3.0E-07
sp|Q5PDU4|CBIO_SALPA Cobalt import ATP-binding protein CbiO OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cbiO PE=3 SV=1 371 543 3.0E-07
sp|Q8Z5N5|CBIO_SALTI Cobalt import ATP-binding protein CbiO OS=Salmonella typhi GN=cbiO PE=3 SV=1 371 543 3.0E-07
sp|O68877|HMUV_PSEAE Hemin import ATP-binding protein HmuV OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=hmuV PE=3 SV=1 371 580 3.0E-07
sp|Q02FW7|HMUV_PSEAB Hemin import ATP-binding protein HmuV OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=hmuV PE=3 SV=1 371 580 3.0E-07
sp|P54933|SMOK_RHOSH ATP-binding transport protein SmoK OS=Rhodobacter sphaeroides GN=smoK PE=3 SV=2 103 292 3.0E-07
sp|Q89WG0|UGPC_BRADU sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ugpC PE=3 SV=1 371 540 3.0E-07
sp|Q6DB87|RBSA_PECAS Ribose import ATP-binding protein RbsA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rbsA PE=3 SV=1 101 293 3.0E-07
sp|Q05596|CBIO_SALTY Cobalt import ATP-binding protein CbiO OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cbiO PE=1 SV=2 371 543 4.0E-07
sp|Q0TC10|UGPC_ECOL5 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ugpC PE=3 SV=1 201 297 4.0E-07
sp|Q1R5H8|UGPC_ECOUT sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli (strain UTI89 / UPEC) GN=ugpC PE=3 SV=2 201 297 4.0E-07
sp|A1AGY1|UGPC_ECOK1 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O1:K1 / APEC GN=ugpC PE=3 SV=1 201 297 4.0E-07
sp|Q8FCQ2|UGPC_ECOL6 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ugpC PE=3 SV=2 201 297 4.0E-07
sp|A1JIE0|UGPC_YERE8 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ugpC PE=3 SV=1 103 272 4.0E-07
sp|Q1MQ44|POTA_LAWIP Spermidine/putrescine import ATP-binding protein PotA OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=potA PE=3 SV=1 103 316 4.0E-07
sp|Q5ZWE4|POTA_LEGPH Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=potA PE=3 SV=2 103 292 5.0E-07
sp|Q2J2E9|UGPC_RHOP2 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodopseudomonas palustris (strain HaA2) GN=ugpC PE=3 SV=1 371 539 6.0E-07
sp|Q6NDQ0|UGPC_RHOPA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ugpC PE=3 SV=1 374 540 6.0E-07
sp|Q6GEL4|ECFA2_STAAR Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain MRSA252) GN=ecfA2 PE=3 SV=1 103 292 6.0E-07
sp|Q7NRX5|UGPC_CHRVO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ugpC PE=3 SV=1 103 292 7.0E-07
sp|P10907|UGPC_ECOLI sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli (strain K12) GN=ugpC PE=1 SV=3 201 297 8.0E-07
sp|Q3YW77|UGPC_SHISS sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Shigella sonnei (strain Ss046) GN=ugpC PE=3 SV=2 201 297 8.0E-07
sp|Q31VH5|UGPC_SHIBS sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Shigella boydii serotype 4 (strain Sb227) GN=ugpC PE=3 SV=2 201 297 8.0E-07
sp|Q8X6U5|UGPC_ECO57 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O157:H7 GN=ugpC PE=3 SV=2 201 297 9.0E-07
sp|Q8FUU5|ZNUC_BRUSU Zinc import ATP-binding protein ZnuC OS=Brucella suis biovar 1 (strain 1330) GN=znuC PE=3 SV=1 103 309 9.0E-07
sp|Q3K506|SSUB_PSEPF Aliphatic sulfonates import ATP-binding protein SsuB OS=Pseudomonas fluorescens (strain Pf0-1) GN=ssuB PE=3 SV=1 103 292 1.0E-06
sp|Q8FW07|UGPC_BRUSU sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella suis biovar 1 (strain 1330) GN=ugpC PE=3 SV=1 103 292 1.0E-06
sp|Q578E9|UGPC_BRUAB sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella abortus biovar 1 (strain 9-941) GN=ugpC PE=3 SV=1 103 292 1.0E-06
sp|Q2YKR8|UGPC_BRUA2 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella abortus (strain 2308) GN=ugpC PE=3 SV=1 103 292 1.0E-06
sp|Q8DRR9|ECFA1_STRMU Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=ecfA1 PE=3 SV=1 83 292 1.0E-06
sp|O57872|Y132_PYRHO Putative ABC transporter ATP-binding protein PH0132 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0132 PE=3 SV=1 372 541 1.0E-06
sp|Q9Z3R9|AGLK_RHIME Alpha-glucoside transport ATP-binding protein AglK OS=Rhizobium meliloti (strain 1021) GN=aglK PE=3 SV=2 371 538 1.0E-06
sp|Q2SRI1|ECFA1_MYCCT Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=ecfA1 PE=3 SV=1 32 295 1.0E-06
sp|Q8RCU0|PSTB1_CALS4 Phosphate import ATP-binding protein PstB 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pstB1 PE=3 SV=1 361 541 1.0E-06
sp|Q8RBQ1|RGMG_CALS4 Putative ribose/galactose/methyl galactoside import ATP-binding protein OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE0763 PE=3 SV=1 371 547 1.0E-06
sp|Q9PKX1|Y339_CHLMU Probable metal transport system ATP-binding protein TC_0339 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=TC_0339 PE=3 SV=1 377 577 2.0E-06
sp|O28437|Y1841_ARCFU Putative ABC transporter ATP-binding protein AF_1841 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1841 PE=3 SV=1 348 550 2.0E-06
sp|Q8D954|UGPC_VIBVU sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Vibrio vulnificus (strain CMCP6) GN=ugpC PE=3 SV=1 103 292 2.0E-06
sp|Q0S0X2|SSUB3_RHOJR Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Rhodococcus jostii (strain RHA1) GN=ssuB3 PE=3 SV=1 103 292 3.0E-06
sp|Q8ES39|Y804_OCEIH Putative ABC transporter ATP-binding protein OB0804 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=OB0804 PE=3 SV=1 74 283 3.0E-06
sp|Q9Z8J5|Y348_CHLPN Probable metal transport system ATP-binding protein CPn_0348/CP_0412/CPj0348/CpB0355 OS=Chlamydia pneumoniae GN=CPn_0348 PE=3 SV=1 377 539 3.0E-06
sp|Q9I6L0|CYSA_PSEAE Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysA PE=3 SV=1 101 292 3.0E-06
sp|Q8H1R4|AB10I_ARATH ABC transporter I family member 10, chloroplastic OS=Arabidopsis thaliana GN=ABCI10 PE=2 SV=1 96 300 3.0E-06
sp|Q7MLB8|UGPC_VIBVY sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Vibrio vulnificus (strain YJ016) GN=ugpC PE=3 SV=2 103 292 3.0E-06
sp|Q6F1W5|ECFA1_MESFL Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=ecfA1 PE=3 SV=1 103 294 4.0E-06
sp|Q3ATY5|LOLD1_CHLCH Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Chlorobium chlorochromatii (strain CaD3) GN=lolD1 PE=3 SV=1 103 297 4.0E-06
sp|Q8VNL9|ECFA_ENTFC Energy-coupling factor transporter ATP-binding protein EcfA OS=Enterococcus faecium GN=ecfA PE=3 SV=1 103 279 5.0E-06
sp|Q3B276|LOLD2_CHLL7 Lipoprotein-releasing system ATP-binding protein LolD 2 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=lolD2 PE=3 SV=1 103 278 6.0E-06
sp|Q38UT9|ECFA1_LACSS Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=ecfA1 PE=3 SV=1 103 279 7.0E-06
sp|Q0SIB7|HMUV_RHOJR Hemin import ATP-binding protein HmuV OS=Rhodococcus jostii (strain RHA1) GN=hmuV PE=3 SV=1 376 539 7.0E-06
sp|Q88AS5|CYSA_PSESM Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cysA PE=3 SV=1 90 292 7.0E-06
sp|Q39GW5|SSUB1_BURL3 Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ssuB1 PE=3 SV=1 103 292 8.0E-06
sp|Q0BFQ0|SSUB_BURCM Aliphatic sulfonates import ATP-binding protein SsuB OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ssuB PE=3 SV=1 65 292 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016887 ATPase activity Yes
GO:0005524 ATP binding Yes
GO:0032553 ribonucleotide binding No
GO:0016462 pyrophosphatase activity No
GO:0003674 molecular_function No
GO:0008144 drug binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0032555 purine ribonucleotide binding No
GO:0016787 hydrolase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8742
MTDKLTRIAIVNSDKCRPRKCRQECKKSCPVVRSGKLCIEVAPESRIAFISESLCIGCGICVKKCPFDAITIINL
PTNLENQVTHRYGPNSFKLHRLPMPRPGQVLGLVGTNGIGKSTALKVLSGKLKPNLGRHDNPPDWEDVIKHFRGS
ELQNYFTKLLEDDLKAVVKPQYVDQIPKAVRGPEKSVRALIDSRASLGNAKEVADILELNHIMDRDITLLSGGEL
QRFAIGTVCVQKADVYMFDEPSSYLDVKQRLSAAQIIRSLLRDDDYVIVVEHDLSVLDYLSDYICVLYGQPAVYG
VVTLPHSVREGINIFLDGHIPTENLRFRDESLTFRIAEGTDDFAIDKSRAFNYPAMEKKLGSFQLRIDAGEFTDS
EIIVMMGENGTGKTTFCRLLAGALKPDSKAGVPEMRISMKPQTITPKFEGTVRQLFFKKIKQAFLNPQFQTDVVK
PLKLDDFIDQEVKNLSGGELQRVAIVLSLGMPADIYLIDEPSAYLDSEQRIIASRVIKRFIMHSKKTAFVVEHDF
IMATYLADRVIVFDGEPGIDAHANRPESLLTGCNTFLKNLDVTFRRDPTNYRPRINKLGSQLDQEQKLNGNFFFL
EETPDKSS*
Coding >Hirsu2|8742
ATGACAGACAAGCTCACCCGAATTGCCATCGTCAACAGCGACAAATGTCGCCCTCGAAAATGCCGCCAGGAGTGC
AAGAAATCATGCCCCGTCGTCCGCAGCGGCAAGCTCTGCATCGAGGTCGCCCCCGAATCCCGCATCGCCTTCATC
TCCGAGTCGCTGTGCATCGGCTGCGGTATCTGCGTCAAGAAATGCCCGTTTGATGCCATCACCATCATCAACCTG
CCGACCAACCTCGAGAACCAGGTGACGCATCGATATGGCCCCAATAGCTTCAAGCTGCACCGCTTGCCCATGCCC
CGCCCGGGCCAGGTCCTCGGTCTTGTCGGAACCAACGGTATCGGCAAGAGCACTGCTCTCAAGGTTCTCAGCGGC
AAGCTCAAGCCCAATCTGGGCCGCCATGACAACCCTCCGGACTGGGAGGATGTCATTAAGCACTTCCGCGGCTCT
GAACTCCAAAATTACTTCACCAAACTCCTTGAGGACGACCTCAAGGCTGTCGTCAAGCCGCAGTATGTCGATCAG
ATCCCAAAGGCCGTCCGTGGCCCCGAAAAAAGCGTCCGCGCCCTCATCGACAGCCGGGCCTCGCTCGGAAATGCC
AAGGAGGTTGCCGACATCTTGGAGCTCAACCACATCATGGATCGCGACATCACCTTGCTGTCGGGCGGAGAGCTT
CAGCGATTTGCCATTGGCACCGTTTGTGTCCAGAAGGCCGACGTCTACATGTTCGACGAGCCTTCGTCCTACCTC
GACGTCAAACAGAGGCTGAGTGCCGCGCAAATCATCCGCTCCCTGCTGCGCGACGATGACTATGTTATTGTCGTC
GAGCACGACTTGTCCGTCTTGGACTACCTCTCCGACTACATCTGCGTTCTTTACGGCCAGCCGGCCGTCTACGGC
GTCGTCACTCTGCCGCACTCTGTGCGAGAAGGCATCAACATCTTCCTCGACGGGCACATCCCGACCGAGAATCTG
CGTTTCCGCGACGAATCCCTGACCTTCCGCATCGCCGAGGGCACGGACGACTTTGCCATTGACAAGTCTCGCGCC
TTCAACTACCCCGCGATGGAGAAAAAGCTTGGTAGCTTTCAGCTCCGCATCGACGCCGGCGAGTTCACCGACTCG
GAGATCATCGTCATGATGGGAGAGAACGGAACCGGCAAGACGACTTTCTGCCGCCTCCTGGCCGGTGCCCTGAAG
CCTGACAGCAAGGCCGGCGTCCCCGAGATGAGGATCAGCATGAAGCCGCAGACCATCACGCCCAAGTTCGAAGGC
ACCGTCCGCCAGCTGTTCTTCAAGAAGATCAAGCAGGCCTTTTTGAACCCGCAATTCCAGACGGACGTCGTGAAG
CCGCTCAAGCTCGATGACTTCATCGACCAGGAGGTCAAGAACCTGTCCGGCGGTGAACTCCAGCGCGTCGCCATC
GTCCTCTCCCTCGGCATGCCCGCCGACATCTACCTCATCGACGAGCCGTCGGCCTATCTCGACTCGGAGCAGCGC
ATCATTGCCTCGCGCGTCATCAAGCGCTTCATCATGCATTCCAAGAAGACGGCCTTCGTCGTCGAGCACGACTTC
ATCATGGCAACCTACCTGGCCGACCGAGTCATCGTCTTCGACGGCGAGCCCGGCATCGATGCCCACGCAAACAGG
CCCGAGTCGCTCTTGACCGGCTGCAACACCTTCCTGAAGAACCTGGACGTGACCTTCCGCCGCGACCCCACCAAC
TACCGCCCGCGTATCAACAAGCTGGGGTCTCAGCTTGACCAGGAACAGAAGTTGAATGGCAACTTCTTCTTCCTG
GAGGAGACGCCCGATAAGAGCTCTTGA
Transcript >Hirsu2|8742
ATGACAGACAAGCTCACCCGAATTGCCATCGTCAACAGCGACAAATGTCGCCCTCGAAAATGCCGCCAGGAGTGC
AAGAAATCATGCCCCGTCGTCCGCAGCGGCAAGCTCTGCATCGAGGTCGCCCCCGAATCCCGCATCGCCTTCATC
TCCGAGTCGCTGTGCATCGGCTGCGGTATCTGCGTCAAGAAATGCCCGTTTGATGCCATCACCATCATCAACCTG
CCGACCAACCTCGAGAACCAGGTGACGCATCGATATGGCCCCAATAGCTTCAAGCTGCACCGCTTGCCCATGCCC
CGCCCGGGCCAGGTCCTCGGTCTTGTCGGAACCAACGGTATCGGCAAGAGCACTGCTCTCAAGGTTCTCAGCGGC
AAGCTCAAGCCCAATCTGGGCCGCCATGACAACCCTCCGGACTGGGAGGATGTCATTAAGCACTTCCGCGGCTCT
GAACTCCAAAATTACTTCACCAAACTCCTTGAGGACGACCTCAAGGCTGTCGTCAAGCCGCAGTATGTCGATCAG
ATCCCAAAGGCCGTCCGTGGCCCCGAAAAAAGCGTCCGCGCCCTCATCGACAGCCGGGCCTCGCTCGGAAATGCC
AAGGAGGTTGCCGACATCTTGGAGCTCAACCACATCATGGATCGCGACATCACCTTGCTGTCGGGCGGAGAGCTT
CAGCGATTTGCCATTGGCACCGTTTGTGTCCAGAAGGCCGACGTCTACATGTTCGACGAGCCTTCGTCCTACCTC
GACGTCAAACAGAGGCTGAGTGCCGCGCAAATCATCCGCTCCCTGCTGCGCGACGATGACTATGTTATTGTCGTC
GAGCACGACTTGTCCGTCTTGGACTACCTCTCCGACTACATCTGCGTTCTTTACGGCCAGCCGGCCGTCTACGGC
GTCGTCACTCTGCCGCACTCTGTGCGAGAAGGCATCAACATCTTCCTCGACGGGCACATCCCGACCGAGAATCTG
CGTTTCCGCGACGAATCCCTGACCTTCCGCATCGCCGAGGGCACGGACGACTTTGCCATTGACAAGTCTCGCGCC
TTCAACTACCCCGCGATGGAGAAAAAGCTTGGTAGCTTTCAGCTCCGCATCGACGCCGGCGAGTTCACCGACTCG
GAGATCATCGTCATGATGGGAGAGAACGGAACCGGCAAGACGACTTTCTGCCGCCTCCTGGCCGGTGCCCTGAAG
CCTGACAGCAAGGCCGGCGTCCCCGAGATGAGGATCAGCATGAAGCCGCAGACCATCACGCCCAAGTTCGAAGGC
ACCGTCCGCCAGCTGTTCTTCAAGAAGATCAAGCAGGCCTTTTTGAACCCGCAATTCCAGACGGACGTCGTGAAG
CCGCTCAAGCTCGATGACTTCATCGACCAGGAGGTCAAGAACCTGTCCGGCGGTGAACTCCAGCGCGTCGCCATC
GTCCTCTCCCTCGGCATGCCCGCCGACATCTACCTCATCGACGAGCCGTCGGCCTATCTCGACTCGGAGCAGCGC
ATCATTGCCTCGCGCGTCATCAAGCGCTTCATCATGCATTCCAAGAAGACGGCCTTCGTCGTCGAGCACGACTTC
ATCATGGCAACCTACCTGGCCGACCGAGTCATCGTCTTCGACGGCGAGCCCGGCATCGATGCCCACGCAAACAGG
CCCGAGTCGCTCTTGACCGGCTGCAACACCTTCCTGAAGAACCTGGACGTGACCTTCCGCCGCGACCCCACCAAC
TACCGCCCGCGTATCAACAAGCTGGGGTCTCAGCTTGACCAGGAACAGAAGTTGAATGGCAACTTCTTCTTCCTG
GAGGAGACGCCCGATAAGAGCTCTTGA
Gene >Hirsu2|8742
ATGACAGACAAGCTCACCCGGTGCGCCTCACGGCCGACGCCCGCCTGTGAGATCCGCTCTTGCTAACCAGAGCGT
CCGCAGAATTGCCATCGTCAACAGCGACAAAGTGAGTCCCAGACCCCACCAAGCCCCTCATCCGACCGTGGCTGA
CCCCCTCGGCCCGCAGTGTCGCCCTCGAAAATGCCGCCAGGAGTGCAAGAAATCATGCCCCGTCGTCCGCAGCGG
CAAGCTCTGCATCGAGGTCGCCCCCGAATCCCGCATCGCCTTCATCTCCGAGTCGCTGTGCATCGGCTGCGGTAT
CTGCGTCAAGAAATGCCCGTTTGATGCCATCACCATCATCAACCTGCCGACCAACCTCGAGAACCAGGTGACGCA
TCGATATGGCCCCAATAGCTTCAAGCTGCACCGCTTGCCCATGCCCCGCCCGGGCCAGGTCCTCGGTCTTGTCGG
AACCAACGGTATCGGCAAGAGCACTGCTCTCAAGGTTCTCAGCGGCAAGCTCAAGCCCAATCTGGGCCGCCATGA
CAACCCTCCGGACTGGGAGGATGTCATTAAGCACTTCCGCGGCTCTGAACTCCAAAGTCGGTCCCCAGACTCCGC
CAATCCGTCCCCCTCCGCCCACGTTCTGACGCTCTCGTTATAGATTACTTCACCAAACTCCTTGAGGACGACCTC
AAGGCTGTCGTCAAGCCGCAGTATGTCGATCAGATCCCAAAGGCCGTCCGTGGCCCCGAAAAAAGCGTCCGCGCC
CTCATCGACAGCCGGGCCTCGCTCGGAAATGCCAAGGAGGTTGCCGACATCTTGGAGCTCAACCACATCATGGAT
CGCGACATCACCTTGCTGTCGGGCGGAGAGCTTCAGCGATTTGCCATTGGCACCGTTTGTGTCCAGAAGGCCGAC
GTCTACATGTTCGACGAGCCTTCGTCCTACCTCGACGTCAAACAGAGGCTGAGTGCCGCGCAAATCATCCGCTCC
CTGCTGCGCGACGATGACTATGTTATTGTCGTCGAGCACGACTTGTCCGTCTTGGACTACCTCTCCGACTACATC
TGCGTTCTTTACGGCCAGCCGGCCGTCTACGGCGTCGTCACTCTGCCGCACTCTGTGCGAGAAGGCATCAACATC
TTCCTCGACGGGCACATCCCGACCGAGAATCTGCGTTTCCGCGACGAATCCCTGACCTTCCGCATCGCCGAGGGC
ACGGACGACTTTGCCATTGACAAGTCTCGCGCCTTCAACTACCCCGCGATGGAGAAAAAGCTTGGTAGCTTTCAG
CTCCGCATCGACGCCGGCGAGTTCACCGACTCGGAGATCATCGTCATGATGGGAGAGAACGGAACCGGCAAGACG
ACTTTCTGCCGCCTCCTGGCCGGTGCCCTGAAGCCTGACAGCAAGGCCGGCGTCCCCGAGATGAGGATCAGCATG
AAGCCGCAGACCATCACGCCCAAGTTCGAAGGCACCGTCCGCCAGCTGTTCTTCAAGAAGATCAAGCAGGCCTTT
TTGAACCCGCAATTCCAGACGGACGTCGTGAAGCCGCTCAAGCTCGATGACTTCATCGACCAGGAGGTCAAGAAC
CTGTCCGGCGGTGAACTCCAGCGCGTCGCCATCGTCCTCTCCCTCGGCATGCCCGCCGACATCTACCTCATCGAC
GAGCCGTCGGCCTATCTCGACTCGGAGCAGCGCATCATTGCCTCGCGCGTCATCAAGCGCTTCATCATGCATTCC
AAGAAGACGGCCTTCGTCGTCGAGCACGACTTCATCATGGCAACCTACCTGGCCGACCGAGTCATCGTCTTCGAC
GGCGAGCCCGGCATCGATGCCCACGCAAACAGGCCCGAGTCGCTCTTGACCGGCTGCAACACCTTCCTGAAGAAC
CTGGACGTGACCTTCCGCCGCGACCCCACCAACTACCGCCCGCGTATCAACAAGCTGGGGTCTCAGCTTGACCAG
GAACAGAAGTTGAATGGCAACTTCGTAAGTACCGCCTCTTTGATGCTTCTTACGCTGCCCGCGGCGGCCCGGCTG
ACGCTTTCGCAGTTCTTCCTGGAGGAGACGCCCGATAAGAGCTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail