Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8741
Gene name
LocationContig_590:1128..3882
Strand+
Gene length (bp)2754
Transcript length (bp)2403
Coding sequence length (bp)2403
Protein length (aa) 801

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01846 FF FF domain 9.3E-09 157 206
PF01846 FF FF domain 8.1E-08 226 274
PF01846 FF FF domain 5.1E-07 370 423
PF00397 WW WW domain 8.1E-10 16 42
PF00397 WW WW domain 3.3E-07 57 83

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14176|PRP40_SCHPO Pre-mRNA-processing protein prp40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp40 PE=1 SV=1 14 573 3.0E-97
sp|P33203|PRP40_YEAST Pre-mRNA-processing protein PRP40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP40 PE=1 SV=1 15 549 2.0E-45
sp|B6EUA9|PR40A_ARATH Pre-mRNA-processing protein 40A OS=Arabidopsis thaliana GN=PRP40A PE=1 SV=1 7 565 5.0E-43
sp|O75400|PR40A_HUMAN Pre-mRNA-processing factor 40 homolog A OS=Homo sapiens GN=PRPF40A PE=1 SV=2 152 559 3.0E-40
sp|Q9R1C7|PR40A_MOUSE Pre-mRNA-processing factor 40 homolog A OS=Mus musculus GN=Prpf40a PE=1 SV=1 144 559 3.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14176|PRP40_SCHPO Pre-mRNA-processing protein prp40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp40 PE=1 SV=1 14 573 3.0E-97
sp|P33203|PRP40_YEAST Pre-mRNA-processing protein PRP40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP40 PE=1 SV=1 15 549 2.0E-45
sp|B6EUA9|PR40A_ARATH Pre-mRNA-processing protein 40A OS=Arabidopsis thaliana GN=PRP40A PE=1 SV=1 7 565 5.0E-43
sp|O75400|PR40A_HUMAN Pre-mRNA-processing factor 40 homolog A OS=Homo sapiens GN=PRPF40A PE=1 SV=2 152 559 3.0E-40
sp|Q9R1C7|PR40A_MOUSE Pre-mRNA-processing factor 40 homolog A OS=Mus musculus GN=Prpf40a PE=1 SV=1 144 559 3.0E-40
sp|P34600|YO61_CAEEL WW domain-containing protein ZK1098.1 OS=Caenorhabditis elegans GN=ZK1098.1 PE=1 SV=2 9 555 5.0E-39
sp|Q80W14|PR40B_MOUSE Pre-mRNA-processing factor 40 homolog B OS=Mus musculus GN=Prpf40b PE=1 SV=2 152 617 2.0E-35
sp|Q6NWY9|PR40B_HUMAN Pre-mRNA-processing factor 40 homolog B OS=Homo sapiens GN=PRPF40B PE=1 SV=1 152 564 3.0E-33
sp|F4JCC1|PR35B_ARATH Pre-mRNA-processing protein 40B OS=Arabidopsis thaliana GN=PRP40B PE=1 SV=1 152 693 3.0E-27
sp|O75400|PR40A_HUMAN Pre-mRNA-processing factor 40 homolog A OS=Homo sapiens GN=PRPF40A PE=1 SV=2 5 91 9.0E-18
sp|Q9R1C7|PR40A_MOUSE Pre-mRNA-processing factor 40 homolog A OS=Mus musculus GN=Prpf40a PE=1 SV=1 17 91 4.0E-17
sp|B6EUA9|PR40A_ARATH Pre-mRNA-processing protein 40A OS=Arabidopsis thaliana GN=PRP40A PE=1 SV=1 14 89 5.0E-16
sp|Q6NWY9|PR40B_HUMAN Pre-mRNA-processing factor 40 homolog B OS=Homo sapiens GN=PRPF40B PE=1 SV=1 11 83 3.0E-15
sp|Q80W14|PR40B_MOUSE Pre-mRNA-processing factor 40 homolog B OS=Mus musculus GN=Prpf40b PE=1 SV=2 11 83 7.0E-15
sp|F4JCC1|PR35B_ARATH Pre-mRNA-processing protein 40B OS=Arabidopsis thaliana GN=PRP40B PE=1 SV=1 3 106 8.0E-15
sp|Q9LT25|PR40C_ARATH Pre-mRNA-processing protein 40C OS=Arabidopsis thaliana GN=MED35C PE=1 SV=1 16 434 2.0E-11
sp|Q5HZF2|WBP4_RAT WW domain-binding protein 4 OS=Rattus norvegicus GN=Wbp4 PE=2 SV=1 17 86 2.0E-10
sp|Q61048|WBP4_MOUSE WW domain-binding protein 4 OS=Mus musculus GN=Wbp4 PE=1 SV=4 16 86 2.0E-10
sp|Q5F457|WBP4_CHICK WW domain-binding protein 4 OS=Gallus gallus GN=WBP4 PE=2 SV=1 17 86 8.0E-09
sp|O75554|WBP4_HUMAN WW domain-binding protein 4 OS=Homo sapiens GN=WBP4 PE=1 SV=1 12 86 1.0E-08
sp|O14776|TCRG1_HUMAN Transcription elongation regulator 1 OS=Homo sapiens GN=TCERG1 PE=1 SV=2 5 372 5.0E-07
sp|Q8CGF7|TCRG1_MOUSE Transcription elongation regulator 1 OS=Mus musculus GN=Tcerg1 PE=1 SV=2 5 359 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2838 0.9363 0.1374 0.0505 0.0262 0.0021 0.0192 0.008 0.0045 0.0011

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4277
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7011
Ophiocordyceps australis map64 (Brazil) OphauB2|2653
Ophiocordyceps camponoti-floridani Ophcf2|07132
Ophiocordyceps camponoti-rufipedis Ophun1|7204
Ophiocordyceps kimflemingae Ophio5|3992
Ophiocordyceps subramaniannii Hirsu2|8741 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8741
MTGFAGPVHGGPPASAWQEHHTPDGRAYFYNSITKVTQWTKPEDMMSPAERALSNQPWKEYTAEGGRKYWYNTET
KQSSWEMPDVFKNALGASENRMSLAAPAAHGPGHGGRQGYRDHGRGSRDSRDLRDSLPDHRQLSRSFVPAADTVP
EYATKEEAEAAFTKVLRRFGVQPDWSWEQAVTTCAKDPQFRAIKAPKARKEAFAKYCQDMVQQEQERAQERFAKL
RIDFETMFKRHPEITHITRWKTARPMIEGETHFRSTDNEQERRQLFDEYITQLKKTHKEQQIAQRKAALEGLREL
LPKLDITAYTRWAEGREIISAATQRDAKYQILTMSEILARFQDHIKSLERALNEKRQRDKKMKFRRERQNRDAFK
GLLADLRRDGHIKAGSKWSQICHLVGDDERYLNMLGQDGPTPPLLFWDMVEDEERALRGPRNDVLDVLEDKRFDL
TPATALEEFMSIMREDRRTANTDPATLQLIFERLREKRAAKREDERHMDRNQRHALDNLRSQLKRLEPPIALGDT
YETVRPRIAKTAEFQAVGSEDSARHAFDRHMRRLRERVEEDSERNHRRNSRVSSERDVPRRNRERSRGDRSHRGG
RSSRRSRSPEPDPYEADRRRAVAERERNHRKSAMAENVLAPGDRARLSPPPRRERDRDHRERDRERDRERDRERD
RERDHDRYGRSRRSEDGHFARERREREDDRERSFRRPVDNRSVDELNYGDERPAGSSASRRRRPDDEEGSSRRDT
RDSKRIKINSSRERTPPREPRPRNKSPPPPPPPKEARDVRSGSEEGEIEE*
Coding >Hirsu2|8741
ATGACCGGCTTCGCAGGCCCCGTTCACGGCGGGCCGCCAGCCTCTGCCTGGCAGGAACACCACACGCCTGATGGC
CGAGCATACTTCTACAACTCCATCACCAAGGTGACCCAGTGGACCAAGCCGGAGGACATGATGAGCCCGGCAGAG
CGCGCCCTATCGAACCAGCCGTGGAAGGAGTACACCGCCGAGGGTGGCAGAAAGTATTGGTACAACACGGAGACG
AAGCAGAGCTCGTGGGAGATGCCCGACGTTTTCAAGAACGCCCTGGGAGCCAGCGAGAATCGGATGTCCTTGGCC
GCGCCCGCGGCCCACGGCCCAGGCCACGGCGGCCGCCAGGGCTATCGCGACCACGGGCGTGGCTCGCGTGACTCG
CGTGACTTGCGTGACTCGCTTCCGGATCATCGCCAGCTGTCGCGATCCTTTGTGCCCGCTGCCGACACTGTCCCC
GAGTACGCAACCAAGGAGGAGGCCGAGGCCGCCTTCACCAAGGTGCTCCGCCGCTTCGGAGTCCAGCCCGACTGG
AGCTGGGAGCAGGCCGTCACGACCTGCGCCAAGGACCCCCAGTTTCGTGCGATCAAGGCCCCGAAGGCCAGGAAG
GAAGCCTTCGCCAAGTACTGCCAGGACATGGTCCAGCAGGAGCAAGAGCGAGCACAGGAGCGCTTTGCAAAGCTG
CGCATCGACTTCGAGACCATGTTCAAGCGACACCCCGAAATCACCCACATCACTCGTTGGAAGACGGCGCGCCCC
ATGATCGAGGGCGAGACGCATTTTCGCTCCACCGACAACGAGCAGGAGCGTCGCCAGCTGTTTGACGAGTACATC
ACCCAGCTTAAGAAGACGCACAAGGAGCAGCAGATCGCCCAGCGAAAGGCGGCCTTGGAGGGGCTCAGAGAGCTG
CTGCCCAAGCTCGACATCACGGCCTACACGCGTTGGGCCGAAGGTCGGGAAATCATCTCGGCTGCCACGCAGAGA
GATGCCAAGTATCAGATTCTCACCATGAGCGAGATCCTGGCTAGGTTCCAGGACCACATCAAGTCTCTCGAGCGC
GCCCTTAACGAGAAGCGACAGCGAGATAAGAAGATGAAGTTCCGCCGGGAGCGCCAGAACAGAGATGCCTTCAAG
GGCCTGTTGGCCGACCTGCGCCGAGATGGTCACATCAAGGCCGGCTCTAAATGGAGCCAGATCTGCCATCTCGTC
GGGGACGACGAGCGATACCTGAACATGCTGGGCCAGGACGGTCCCACGCCCCCGTTGCTGTTCTGGGACATGGTC
GAGGACGAGGAGCGTGCCCTTCGCGGCCCCCGCAACGACGTGCTCGATGTCCTCGAAGACAAACGTTTTGACCTC
ACACCCGCCACTGCCCTGGAAGAGTTCATGTCTATTATGAGAGAGGATCGTAGAACGGCCAACACTGATCCGGCC
ACCTTGCAGCTCATATTCGAACGACTCCGTGAGAAGCGAGCCGCCAAACGAGAAGACGAACGGCATATGGACCGC
AATCAGCGGCACGCACTCGACAACCTTCGTTCGCAATTGAAACGCCTCGAACCCCCGATTGCACTGGGCGACACC
TACGAGACTGTGCGACCCCGAATTGCAAAGACGGCGGAGTTCCAGGCTGTGGGTTCGGAGGATTCCGCCCGACAC
GCCTTCGACAGGCACATGCGCCGTCTTAGGGAGAGGGTGGAAGAGGATTCGGAACGAAATCATCGTCGCAACAGC
CGCGTCTCGAGCGAGCGGGATGTGCCTCGTCGTAACAGGGAGCGCTCGAGGGGCGACAGGTCCCATCGTGGCGGG
CGCTCCTCGCGACGCAGCCGCAGCCCGGAGCCGGATCCTTACGAGGCCGACAGGCGACGAGCTGTCGCAGAGCGA
GAGCGAAACCACCGCAAGTCAGCCATGGCGGAGAACGTGCTGGCGCCGGGGGACCGAGCGCGTCTCAGCCCGCCC
CCGCGTCGCGAGCGCGACCGCGACCACCGGGAACGAGACCGGGAACGAGACCGAGAACGAGACCGAGAACGAGAC
CGAGAGCGTGACCACGATCGCTATGGCCGCTCCCGCCGAAGCGAGGATGGGCATTTCGCCCGGGAGCGTAGGGAG
AGGGAAGACGATCGCGAGCGGTCTTTCCGCCGTCCGGTCGACAACCGCTCGGTCGACGAACTGAACTACGGGGAC
GAGAGGCCTGCGGGGTCGTCAGCCTCGCGACGTCGTCGACCCGACGATGAGGAAGGCTCGTCGCGGAGAGATACA
CGAGATTCAAAGAGAATCAAAATCAACTCGTCGCGAGAGCGGACGCCACCGCGCGAGCCTCGCCCGAGGAACAAG
TCCCCCCCGCCGCCGCCGCCGCCCAAGGAAGCGCGAGACGTCCGGAGCGGAAGCGAGGAGGGCGAGATCGAGGAG
TGA
Transcript >Hirsu2|8741
ATGACCGGCTTCGCAGGCCCCGTTCACGGCGGGCCGCCAGCCTCTGCCTGGCAGGAACACCACACGCCTGATGGC
CGAGCATACTTCTACAACTCCATCACCAAGGTGACCCAGTGGACCAAGCCGGAGGACATGATGAGCCCGGCAGAG
CGCGCCCTATCGAACCAGCCGTGGAAGGAGTACACCGCCGAGGGTGGCAGAAAGTATTGGTACAACACGGAGACG
AAGCAGAGCTCGTGGGAGATGCCCGACGTTTTCAAGAACGCCCTGGGAGCCAGCGAGAATCGGATGTCCTTGGCC
GCGCCCGCGGCCCACGGCCCAGGCCACGGCGGCCGCCAGGGCTATCGCGACCACGGGCGTGGCTCGCGTGACTCG
CGTGACTTGCGTGACTCGCTTCCGGATCATCGCCAGCTGTCGCGATCCTTTGTGCCCGCTGCCGACACTGTCCCC
GAGTACGCAACCAAGGAGGAGGCCGAGGCCGCCTTCACCAAGGTGCTCCGCCGCTTCGGAGTCCAGCCCGACTGG
AGCTGGGAGCAGGCCGTCACGACCTGCGCCAAGGACCCCCAGTTTCGTGCGATCAAGGCCCCGAAGGCCAGGAAG
GAAGCCTTCGCCAAGTACTGCCAGGACATGGTCCAGCAGGAGCAAGAGCGAGCACAGGAGCGCTTTGCAAAGCTG
CGCATCGACTTCGAGACCATGTTCAAGCGACACCCCGAAATCACCCACATCACTCGTTGGAAGACGGCGCGCCCC
ATGATCGAGGGCGAGACGCATTTTCGCTCCACCGACAACGAGCAGGAGCGTCGCCAGCTGTTTGACGAGTACATC
ACCCAGCTTAAGAAGACGCACAAGGAGCAGCAGATCGCCCAGCGAAAGGCGGCCTTGGAGGGGCTCAGAGAGCTG
CTGCCCAAGCTCGACATCACGGCCTACACGCGTTGGGCCGAAGGTCGGGAAATCATCTCGGCTGCCACGCAGAGA
GATGCCAAGTATCAGATTCTCACCATGAGCGAGATCCTGGCTAGGTTCCAGGACCACATCAAGTCTCTCGAGCGC
GCCCTTAACGAGAAGCGACAGCGAGATAAGAAGATGAAGTTCCGCCGGGAGCGCCAGAACAGAGATGCCTTCAAG
GGCCTGTTGGCCGACCTGCGCCGAGATGGTCACATCAAGGCCGGCTCTAAATGGAGCCAGATCTGCCATCTCGTC
GGGGACGACGAGCGATACCTGAACATGCTGGGCCAGGACGGTCCCACGCCCCCGTTGCTGTTCTGGGACATGGTC
GAGGACGAGGAGCGTGCCCTTCGCGGCCCCCGCAACGACGTGCTCGATGTCCTCGAAGACAAACGTTTTGACCTC
ACACCCGCCACTGCCCTGGAAGAGTTCATGTCTATTATGAGAGAGGATCGTAGAACGGCCAACACTGATCCGGCC
ACCTTGCAGCTCATATTCGAACGACTCCGTGAGAAGCGAGCCGCCAAACGAGAAGACGAACGGCATATGGACCGC
AATCAGCGGCACGCACTCGACAACCTTCGTTCGCAATTGAAACGCCTCGAACCCCCGATTGCACTGGGCGACACC
TACGAGACTGTGCGACCCCGAATTGCAAAGACGGCGGAGTTCCAGGCTGTGGGTTCGGAGGATTCCGCCCGACAC
GCCTTCGACAGGCACATGCGCCGTCTTAGGGAGAGGGTGGAAGAGGATTCGGAACGAAATCATCGTCGCAACAGC
CGCGTCTCGAGCGAGCGGGATGTGCCTCGTCGTAACAGGGAGCGCTCGAGGGGCGACAGGTCCCATCGTGGCGGG
CGCTCCTCGCGACGCAGCCGCAGCCCGGAGCCGGATCCTTACGAGGCCGACAGGCGACGAGCTGTCGCAGAGCGA
GAGCGAAACCACCGCAAGTCAGCCATGGCGGAGAACGTGCTGGCGCCGGGGGACCGAGCGCGTCTCAGCCCGCCC
CCGCGTCGCGAGCGCGACCGCGACCACCGGGAACGAGACCGGGAACGAGACCGAGAACGAGACCGAGAACGAGAC
CGAGAGCGTGACCACGATCGCTATGGCCGCTCCCGCCGAAGCGAGGATGGGCATTTCGCCCGGGAGCGTAGGGAG
AGGGAAGACGATCGCGAGCGGTCTTTCCGCCGTCCGGTCGACAACCGCTCGGTCGACGAACTGAACTACGGGGAC
GAGAGGCCTGCGGGGTCGTCAGCCTCGCGACGTCGTCGACCCGACGATGAGGAAGGCTCGTCGCGGAGAGATACA
CGAGATTCAAAGAGAATCAAAATCAACTCGTCGCGAGAGCGGACGCCACCGCGCGAGCCTCGCCCGAGGAACAAG
TCCCCCCCGCCGCCGCCGCCGCCCAAGGAAGCGCGAGACGTCCGGAGCGGAAGCGAGGAGGGCGAGATCGAGGAG
TGA
Gene >Hirsu2|8741
ATGACCGGCTTCGCAGGCCCCGTTCACGGCGGGCCGCCAGCCTCTGCCTGGCAGGAACACCACACGCCTGATGGC
CGAGCATACTTCTACAACTCCATCACCAAGGTGACCCAGTGGACCAAGCCGGAGGACATGATGAGCCCGGCAGAG
GTAACCAACCCCCCCCCCTCTCCCTCCCTGCCACCCTCCTTCGTGAGAGCTACTGCTGACTCCTCTCTTCCCTCT
CGTCCAGCGCGCCCTATCGAACCAGCCGTGGAAGGAGTACACCGCCGAGGGTGGCAGAAAGTATTGGTACAACAC
GGAGACGAAGCAGAGCTCGTGGGAGATGCCCGACGTTTTCAAGAACGCCCTGGGAGCCAGCGAGAATCGGATGTC
CTTGGCCGCGCCCGCGGCCCACGGCCCAGGCCACGGCGGCCGCCAGGGCTATCGCGACCACGGGCGTGGCTCGCG
TGACTCGCGTGACTTGCGTGACTCGCTTCCGGATCATCGCCAGCTGTCGCGATCCTTTGTGCCCGCTGCCGACAC
TGTCCCCGAGTACGCAACCAAGGAGGAGGCCGAGGCCGCCTTCACCAAGGTGCTCCGCCGCTTCGGAGTCCAGCC
CGACTGGAGCTGGGAGCAGGCCGTCACGACCTGCGCCAAGGACCCCCAGTTTCGTGCGATCAAGGCCCCGAAGGC
CAGGAAGGAAGCCTTCGCCAAGTACTGCCAGGACATGGTCCAGCAGGAGCAAGAGCGAGCACAGGAGCGCTTTGC
AAAGCTGCGCATCGACTTCGAGACCATGTTCAAGCGACACCCCGAAATCACCCACATCACTCGTTGGAAGACGGC
GCGCCCCATGATCGAGGGCGAGACGCATTTTCGCTCCACCGACAACGAGCAGGAGCGTCGCCAGCTGTTTGACGA
GTACATCACCCAGCTTAAGAAGACGCACAAGGAGCAGCAGATCGCCCAGCGAAAGGCGGCCTTGGAGGGGCTCAG
AGAGCTGCTGCCCAAGCTCGACATCACGGCCTACACGCGTTGGGCCGAAGGTCGGGAAATCATCTCGGCTGCCAC
GCAGAGAGATGCCAAGTATCAGATTCTCACCATGAGCGAGATCCTGGCTAGGTTCCAGGACCACATCAAGTCTCT
CGAGCGCGCCCTTAACGAGAAGCGACAGCGAGATAAGAAGATGAAGTTCCGCCGGGAGCGCCAGAACAGAGATGC
CTTCAAGGGCCTGTTGGCCGACCTGCGCCGAGATGGTCACATCAAGGCCGGCTCTAAATGGAGCCAGATCTGCCA
TCTCGTCGGGGACGACGAGCGATACCTGAACATGCTGGGCCAGGACGGTCCCACGCCCCCGTTGCTGTTCTGGGA
CATGGTCGAGGACGAGGAGCGTGCCCTTCGCGGCCCCCGCAACGACGTGCTCGATGTCCTCGAAGTGAGCGATTC
ATCCTCGTCCCCCTCTTTCCACTACTAGTATACCCCTTTCTAACATTCGGGCCTTGAAGGACAAACGTTTTGACC
TCACACCCGCCACTGCCCTGGAAGAGTTCATGTCTATTATGAGAGAGGATCGTAGAACGGCCAACACTGATCCGG
CCACCTTGCAGCTCATATTCGAACGAGTGAGCACCCACTCAGTCTTTACCGTTTTGTTCCCTTGTTTCCTTGTTT
CGTTGTTTCCTTCATTCCCTTTCATTTCGCTTCGGTTTGGTGTTCCCGCCTTTTTCCAGCATTTCTGACGACGGC
CGTTAGCTCCGTGAGAAGCGAGCCGCCAAACGAGAAGACGAACGGCATATGGACCGCAATCAGCGGCACGCACTC
GACAACCTTCGTTCGCAATTGAAACGCCTCGAACCCCCGATTGCACTGGGCGACACCTACGAGACTGTGCGACCC
CGAATTGCAAAGACGGCGGAGTTCCAGGCTGTGGGTTCGGAGGATTCCGCCCGACACGCCTTCGACAGGCACATG
CGCCGTCTTAGGGAGAGGGTGGAAGAGGATTCGGAACGAAATCATCGTCGCAACAGCCGCGTCTCGAGCGAGCGG
GATGTGCCTCGTCGTAACAGGGAGCGCTCGAGGGGCGACAGGTCCCATCGTGGCGGGCGCTCCTCGCGACGCAGC
CGCAGCCCGGAGCCGGATCCTTACGAGGCCGACAGGCGACGAGCTGTCGCAGAGCGAGAGCGAAACCACCGCAAG
TCAGCCATGGCGGAGAACGTGCTGGCGCCGGGGGACCGAGCGCGTCTCAGCCCGCCCCCGCGTCGCGAGCGCGAC
CGCGACCACCGGGAACGAGACCGGGAACGAGACCGAGAACGAGACCGAGAACGAGACCGAGAGCGTGACCACGAT
CGCTATGGCCGCTCCCGCCGAAGCGAGGATGGGCATTTCGCCCGGGAGCGTAGGGAGAGGGAAGACGATCGCGAG
CGGTCTTTCCGCCGTCCGGTCGACAACCGCTCGGTCGACGAACTGAACTACGGGGACGAGAGGCCTGCGGGGTCG
TCAGCCTCGCGACGTCGTCGACCCGACGATGAGGAAGGCTCGTCGCGGAGAGATACACGAGATTCAAAGGCACAA
TTTCCCCGCCACGAACCCCCCCGATTAACCCAGTTTCCGTTCCGCTGACCCCCCTGGCCGCAGAGAATCAAAATC
AACTCGTCGCGAGAGCGGACGCCACCGCGCGAGCCTCGCCCGAGGAACAAGTCCCCCCCGCCGCCGCCGCCGCCC
AAGGAAGCGCGAGACGTCCGGAGCGGAAGCGAGGAGGGCGAGATCGAGGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail