Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8734
Gene name
LocationContig_59:34885..37941
Strand+
Gene length (bp)3056
Transcript length (bp)2553
Coding sequence length (bp)2553
Protein length (aa) 851

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 7.6E-175 139 807

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 117 844 5.0E-136
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 11 828 5.0E-135
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 118 820 3.0E-113
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 106 831 4.0E-110
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 118 843 3.0E-107
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 117 844 5.0E-136
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 11 828 5.0E-135
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 118 820 3.0E-113
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 106 831 4.0E-110
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 118 843 3.0E-107
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 90 835 8.0E-107
sp|Q9FME8|OPT4_ARATH Oligopeptide transporter 4 OS=Arabidopsis thaliana GN=OPT4 PE=1 SV=1 117 831 9.0E-107
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 117 835 2.0E-102
sp|O82485|OPT7_ARATH Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1 119 831 2.0E-100
sp|Q9T095|OPT6_ARATH Oligopeptide transporter 6 OS=Arabidopsis thaliana GN=OPT6 PE=2 SV=1 123 835 7.0E-100
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 117 831 8.0E-100
sp|Q9FJD2|OPT9_ARATH Oligopeptide transporter 9 OS=Arabidopsis thaliana GN=OPT9 PE=2 SV=1 123 835 6.0E-95
sp|Q9FJD1|OPT8_ARATH Oligopeptide transporter 8 OS=Arabidopsis thaliana GN=OPT8 PE=2 SV=1 123 835 8.0E-95
sp|Q7LL00|YQJC_SCHPO Uncharacterized oligopeptide transporter C1840.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.12 PE=3 SV=2 123 836 7.0E-83
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 141 163 22
2 250 272 22
3 320 342 22
4 394 416 22
5 468 490 22
6 530 549 19
7 556 578 22
8 598 620 22
9 640 662 22
10 677 696 19
11 703 725 22
12 757 774 17
13 787 809 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8734
MGEKTAAPADAQSAEALSTWSSVRDYARGSLAQKASLLGASSGDVLDAEEFAATLDVDEALRRAEEVIRVHEHDP
NFSSGAMMRLQAAAGRPELLRGPDADADLVAALKTEVALVTNNSPYAEVRAVVGNRDDASTPASTVRAWAIGMLF
VVVLSFVNQLFSVRQPSIRLDPPVVQLLSFPLGKAWERWMPAREFVLFGTRHRLNPGRFNQKEHMLISIMANVAK
ALPHSRYLIFTTWLEKYFNLPFASSFAFQITLALSMNLMGFGLAGLARRFLVYPSFCIWPRSLATVALNQSLHNE
DNPQVQGPFRRLYGISRYRFFLLAFGAMFFWFWVPNYFLSAVSLFNWLAWISPTNFNLTAITGLRKGLGFNPFPT
MDWNVVTHNVEPLLVPPHVTLNMCLGALLGGVTIVAMYWSNTFYTGYLPINTNTMFAHNATTYNVSAILDENGIL
DEAKYQAYSPVYIAASSVTYYIFFFAVYTSVISYAALYHWNDISMGFRSLRNSFRRGGKEDGSKDIHTRLMDAYR
EVPEWWYLILNAAAIVLGVVAVAVWPTHTAVGVVFFGIALALIFTIPTGIIFATTGIEIEYNVLAEFIGGAWQPG
NALAMNLFKGFGYVTVAHALDFANDLKLGHYLKIPPRQTFWCQICAAVVSAFVCTGVMNFQILHIPDICEADQKD
KFSCPGLQSYFTAAVLFGSLGARKVWGAGAQYVAMLAAFPVGLVLPLLYYYATRGLPKNHWLNKVHPVLILSGGI
TWSPYNLGYMWPAVFPSWLSWVYIRRRYFSLWSKYNYVLSAALSTAVAVAAVVIFFALSYHGVNLDWVGNKPDSG
CEAKACTRLKLPTGEYFGPRIGTYV*
Coding >Hirsu2|8734
ATGGGAGAAAAGACGGCGGCCCCGGCCGATGCGCAGTCGGCCGAGGCCCTCAGCACCTGGTCCTCGGTGCGCGAC
TACGCTCGGGGCTCTCTGGCGCAGAAGGCGAGCCTGCTGGGCGCCAGCTCGGGCGACGTGCTCGACGCCGAAGAG
TTCGCGGCGACGCTCGACGTGGACGAGGCCTTGAGGCGGGCCGAGGAGGTGATCCGGGTGCACGAGCACGACCCC
AACTTCAGCTCCGGGGCGATGATGCGGCTCCAGGCGGCGGCGGGCCGGCCCGAGCTCCTGCGGGGCCCGGACGCG
GACGCGGACCTCGTGGCGGCCTTGAAGACGGAGGTGGCGCTCGTGACCAACAACTCGCCCTACGCCGAGGTGCGG
GCCGTGGTCGGCAACCGGGACGACGCGTCGACGCCGGCGAGCACGGTGCGCGCCTGGGCCATCGGCATGCTGTTC
GTCGTCGTCCTCAGCTTCGTCAACCAGCTCTTCTCCGTCCGCCAGCCCAGCATCCGGCTCGACCCGCCCGTCGTC
CAGCTGCTGTCCTTCCCGCTCGGCAAGGCGTGGGAGCGCTGGATGCCGGCCCGCGAGTTCGTCCTGTTCGGCACG
CGCCACCGCCTCAACCCGGGCCGCTTCAACCAGAAGGAGCACATGCTCATCTCCATCATGGCCAACGTCGCCAAG
GCCCTGCCGCACTCGCGATACCTCATCTTCACCACCTGGCTGGAGAAGTACTTCAACCTGCCCTTCGCCTCCTCC
TTCGCCTTCCAGATCACCTTGGCGCTCTCCATGAACCTGATGGGCTTTGGCTTGGCCGGCCTGGCCCGGCGCTTT
CTCGTCTACCCGTCCTTCTGCATCTGGCCTCGCTCCCTCGCGACCGTTGCCCTCAACCAGTCTCTCCACAACGAG
GACAACCCCCAAGTCCAGGGCCCGTTCCGCAGGCTGTACGGCATCTCCAGGTATAGGTTCTTCCTGCTCGCCTTC
GGCGCCATGTTCTTCTGGTTCTGGGTCCCCAACTACTTCCTCTCGGCCGTCTCCCTCTTCAACTGGCTGGCCTGG
ATCTCGCCCACCAACTTCAACCTGACCGCCATCACCGGCCTGAGAAAGGGCCTCGGCTTCAACCCGTTCCCGACG
ATGGACTGGAATGTCGTCACCCACAACGTCGAGCCCCTGCTCGTGCCGCCGCACGTCACGCTCAACATGTGTCTC
GGGGCCTTGTTGGGCGGCGTCACCATCGTCGCCATGTACTGGTCCAACACCTTCTACACGGGCTACCTTCCCATC
AACACCAACACCATGTTCGCCCACAACGCCACCACCTACAACGTGTCCGCCATTCTCGACGAGAACGGCATCCTC
GACGAGGCCAAGTACCAGGCGTACAGCCCGGTCTACATCGCCGCCTCGTCCGTCACGTACTACATCTTCTTCTTC
GCCGTCTACACCTCGGTCATATCCTATGCTGCCTTGTACCACTGGAACGACATTAGCATGGGCTTCCGGTCCTTG
CGGAACAGCTTCAGACGTGGCGGAAAGGAGGACGGCTCCAAGGACATCCACACACGACTGATGGACGCCTACCGC
GAGGTTCCGGAGTGGTGGTACCTGATTCTCAACGCCGCCGCCATCGTCCTCGGTGTCGTCGCTGTAGCAGTGTGG
CCGACGCACACCGCCGTCGGCGTCGTCTTCTTCGGCATCGCGCTCGCCTTGATCTTCACCATCCCCACCGGCATC
ATCTTTGCCACGACAGGCATCGAGATCGAGTACAACGTGCTGGCCGAGTTCATCGGCGGCGCGTGGCAGCCCGGG
AACGCCTTGGCGATGAACCTGTTCAAGGGCTTCGGATACGTGACGGTGGCTCACGCCCTCGACTTCGCCAACGAC
CTGAAGCTCGGCCACTACCTGAAGATTCCGCCGCGCCAGACCTTTTGGTGCCAGATATGCGCCGCCGTCGTCTCG
GCCTTCGTCTGTACCGGCGTCATGAACTTCCAGATCCTGCACATCCCCGACATCTGCGAGGCCGACCAGAAGGAC
AAGTTCAGCTGCCCCGGTCTCCAGTCCTACTTCACCGCCGCCGTCCTCTTCGGCTCCCTGGGCGCGCGCAAGGTC
TGGGGCGCCGGCGCCCAGTACGTCGCCATGCTGGCCGCCTTCCCCGTCGGCCTCGTCCTGCCGCTGCTCTACTAC
TACGCCACGCGCGGCCTACCCAAGAACCACTGGCTCAACAAGGTGCACCCCGTCCTCATCCTGAGCGGCGGCATC
ACCTGGTCGCCCTACAACCTCGGCTACATGTGGCCGGCCGTCTTCCCCAGCTGGCTCTCCTGGGTCTACATCCGC
AGGAGGTACTTCTCGCTGTGGTCCAAGTACAACTACGTCCTGTCGGCCGCGCTCTCGACCGCCGTCGCCGTCGCC
GCCGTCGTCATCTTCTTCGCCCTGAGCTACCACGGCGTCAACCTCGACTGGGTCGGCAACAAGCCGGACAGCGGC
TGCGAGGCCAAGGCCTGCACGCGCCTGAAGCTGCCGACGGGCGAGTATTTCGGGCCCCGAATAGGCACCTACGTT
TAG
Transcript >Hirsu2|8734
ATGGGAGAAAAGACGGCGGCCCCGGCCGATGCGCAGTCGGCCGAGGCCCTCAGCACCTGGTCCTCGGTGCGCGAC
TACGCTCGGGGCTCTCTGGCGCAGAAGGCGAGCCTGCTGGGCGCCAGCTCGGGCGACGTGCTCGACGCCGAAGAG
TTCGCGGCGACGCTCGACGTGGACGAGGCCTTGAGGCGGGCCGAGGAGGTGATCCGGGTGCACGAGCACGACCCC
AACTTCAGCTCCGGGGCGATGATGCGGCTCCAGGCGGCGGCGGGCCGGCCCGAGCTCCTGCGGGGCCCGGACGCG
GACGCGGACCTCGTGGCGGCCTTGAAGACGGAGGTGGCGCTCGTGACCAACAACTCGCCCTACGCCGAGGTGCGG
GCCGTGGTCGGCAACCGGGACGACGCGTCGACGCCGGCGAGCACGGTGCGCGCCTGGGCCATCGGCATGCTGTTC
GTCGTCGTCCTCAGCTTCGTCAACCAGCTCTTCTCCGTCCGCCAGCCCAGCATCCGGCTCGACCCGCCCGTCGTC
CAGCTGCTGTCCTTCCCGCTCGGCAAGGCGTGGGAGCGCTGGATGCCGGCCCGCGAGTTCGTCCTGTTCGGCACG
CGCCACCGCCTCAACCCGGGCCGCTTCAACCAGAAGGAGCACATGCTCATCTCCATCATGGCCAACGTCGCCAAG
GCCCTGCCGCACTCGCGATACCTCATCTTCACCACCTGGCTGGAGAAGTACTTCAACCTGCCCTTCGCCTCCTCC
TTCGCCTTCCAGATCACCTTGGCGCTCTCCATGAACCTGATGGGCTTTGGCTTGGCCGGCCTGGCCCGGCGCTTT
CTCGTCTACCCGTCCTTCTGCATCTGGCCTCGCTCCCTCGCGACCGTTGCCCTCAACCAGTCTCTCCACAACGAG
GACAACCCCCAAGTCCAGGGCCCGTTCCGCAGGCTGTACGGCATCTCCAGGTATAGGTTCTTCCTGCTCGCCTTC
GGCGCCATGTTCTTCTGGTTCTGGGTCCCCAACTACTTCCTCTCGGCCGTCTCCCTCTTCAACTGGCTGGCCTGG
ATCTCGCCCACCAACTTCAACCTGACCGCCATCACCGGCCTGAGAAAGGGCCTCGGCTTCAACCCGTTCCCGACG
ATGGACTGGAATGTCGTCACCCACAACGTCGAGCCCCTGCTCGTGCCGCCGCACGTCACGCTCAACATGTGTCTC
GGGGCCTTGTTGGGCGGCGTCACCATCGTCGCCATGTACTGGTCCAACACCTTCTACACGGGCTACCTTCCCATC
AACACCAACACCATGTTCGCCCACAACGCCACCACCTACAACGTGTCCGCCATTCTCGACGAGAACGGCATCCTC
GACGAGGCCAAGTACCAGGCGTACAGCCCGGTCTACATCGCCGCCTCGTCCGTCACGTACTACATCTTCTTCTTC
GCCGTCTACACCTCGGTCATATCCTATGCTGCCTTGTACCACTGGAACGACATTAGCATGGGCTTCCGGTCCTTG
CGGAACAGCTTCAGACGTGGCGGAAAGGAGGACGGCTCCAAGGACATCCACACACGACTGATGGACGCCTACCGC
GAGGTTCCGGAGTGGTGGTACCTGATTCTCAACGCCGCCGCCATCGTCCTCGGTGTCGTCGCTGTAGCAGTGTGG
CCGACGCACACCGCCGTCGGCGTCGTCTTCTTCGGCATCGCGCTCGCCTTGATCTTCACCATCCCCACCGGCATC
ATCTTTGCCACGACAGGCATCGAGATCGAGTACAACGTGCTGGCCGAGTTCATCGGCGGCGCGTGGCAGCCCGGG
AACGCCTTGGCGATGAACCTGTTCAAGGGCTTCGGATACGTGACGGTGGCTCACGCCCTCGACTTCGCCAACGAC
CTGAAGCTCGGCCACTACCTGAAGATTCCGCCGCGCCAGACCTTTTGGTGCCAGATATGCGCCGCCGTCGTCTCG
GCCTTCGTCTGTACCGGCGTCATGAACTTCCAGATCCTGCACATCCCCGACATCTGCGAGGCCGACCAGAAGGAC
AAGTTCAGCTGCCCCGGTCTCCAGTCCTACTTCACCGCCGCCGTCCTCTTCGGCTCCCTGGGCGCGCGCAAGGTC
TGGGGCGCCGGCGCCCAGTACGTCGCCATGCTGGCCGCCTTCCCCGTCGGCCTCGTCCTGCCGCTGCTCTACTAC
TACGCCACGCGCGGCCTACCCAAGAACCACTGGCTCAACAAGGTGCACCCCGTCCTCATCCTGAGCGGCGGCATC
ACCTGGTCGCCCTACAACCTCGGCTACATGTGGCCGGCCGTCTTCCCCAGCTGGCTCTCCTGGGTCTACATCCGC
AGGAGGTACTTCTCGCTGTGGTCCAAGTACAACTACGTCCTGTCGGCCGCGCTCTCGACCGCCGTCGCCGTCGCC
GCCGTCGTCATCTTCTTCGCCCTGAGCTACCACGGCGTCAACCTCGACTGGGTCGGCAACAAGCCGGACAGCGGC
TGCGAGGCCAAGGCCTGCACGCGCCTGAAGCTGCCGACGGGCGAGTATTTCGGGCCCCGAATAGGCACCTACGTT
TAG
Gene >Hirsu2|8734
ATGGGAGAAAAGACGGCGGCCCCGGCCGATGCGCAGTCGGCCGAGGCCCTCAGCACCTGGTCCTCGGTGCGCGAC
TACGCTCGGGGCTCTCTGGCGCAGAAGGCGAGCCTGCTGGGCGCCAGCTCGGGCGACGTGCTCGACGCCGAAGAG
TTCGCGGCGACGCTCGACGTGGACGAGGCCTTGAGGGTCAGCCAGCCCCCTCCCCCCAGCCCCTTTGGTTTCGTT
TTTTTTTTTTTTTCAGGCCCGCGTGGCGGCGATGGGCGGTGCGGCTAAGCGTTGGCGACTGCAGCGGGCCGAGGA
GGTGATCCGGGTGCACGAGCACGACCCCAACTTCAGCTCCGGGGCGATGATGCGGCTCCAGGCGGCGGCGGGCCG
GCCCGAGCTCCTGCGGGGCCCGGACGCGGACGCGGACCTCGTGGCGGCCTTGAAGACGGAGGTGGCGCTCGTGAC
CAACAACTCGCCCTACGCCGAGGTGCGGGCCGTGGTCGGCAACCGGGACGACGCGTCGACGCCGGCGAGCACGGT
GCGCGCCTGGGCCATCGGCATGCTGTTCGTCGTCGTCCTCAGCTTCGTCAACCAGCTCTTCTCCGTCCGCCAGCC
CAGCATCCGGCTCGACCCGCCCGTCGTCCAGCTGCTGTCCTTCCCGCTCGGCAAGGCGTGGGAGCGCTGGATGCC
GGCCCGCGAGTTCGTCCTGTTCGGCACGCGCCACCGCCTCAACCCGGGCCGCTTCAACCAGAAGGAGCACATGCT
CATCTCCATCATGGCCAACGTCGCCAAGGCCCTGCCGCACTCGCGATACCTCATCTTCACCACCTGGCTGGAGAA
GTACTTCAACCTGCCCTTCGCCTCCTCCTTCGCCTTCCAGATCACCTTGGCGGTAAGTGCTCGCCCGCGGGGAGG
GGGGGGGGAGCATCGTGACGCCGGCTGACCGGACCGCAAGCTCTCCATGAACCTGATGGGCTTTGGCTTGGCCGG
CCTGGCCCGGCGCTTTCTCGTCTACCCGTCCTTCTGCATCTGGCCTCGCTCCCTCGCGACCGTTGCCCTCAACCA
GTCTCTCCACAACGGTTCGCCTCCCCCGGCCGAAGACGGCCGTCGCCATGCCCCTCCCAACCCGCTGACAAGCCG
CAGAGGACAACCCCCAAGTCCAGGGCCCGTTCCGCAGGCTGTACGGCATCTCCAGGTATAGGTTCTTCCTGCTCG
CCTTCGGCGCCATGTTCTTCTGGTTCTGGGTCCCCAACTACTTCCTCTCGGCCGTCTCCCTCTTCAACTGGCTGG
CCTGGATCTCGCCCACCAACTTCAACCTGACCGCCATCACCGGCCTGAGAAAGGGCCTCGGCTTCAACCCGTTCC
CGACGATGGACTGGAATGTCGTCACCCACAACGTCGAGCCCCTGCTCGTGCCGCCGCACGTCACGCTCAACATGT
GTCTCGGGGCCTTGTTGGGCGGCGTCACCATCGTCGCCATGTACTGGTCCAACACCTTCTACACGGGCTACCTTC
CCATCAACACCAACACCATGTTCGCCCACAACGCCACCACCTACAACGTGTCCGCCATTCTCGACGAGAACGGCA
TCCTCGACGAGGCCAAGTACCAGGCGTACAGCCCGGTCTACATCGCCGCCTCGTCCGTCACGTACTAGTGAGTTC
ACGGCGCCGGCCCGGCTCGGATGGGGATGGATGTGCTGACGGGGCCCAGCATCTTCTTCTTCGCCGTCTACACCT
CGGTCATATCCTATGCTGCCTTGTACCACTGGAACGACATTAGCATGGGCTTCCGGTCCTTGCGGAACAGCTTCA
GACGTGGCGGAAAGGAGGACGGCTCCAAGGACATCCACACACGACTGATGGACGCCTACCGCGAGGTTCCGGAGT
GGTGGTACCTGATTCTCAACGCAAGTCGTCCCTCAGACTCTTTCCAGTCGCCAATCTCGGCTCTTCCAGAAGATG
TCTAATGCTCCTCACAGGCCGCCGCCATCGTCCTCGGTGTCGTCGCTGTAGCAGTGTGGCCGACGCACACCGCCG
TCGGCGTCGTCTTCTTCGGCATCGCGCTCGCCTTGATCTTCACCATCCCCACCGGCATCATCTTTGCCACGACAG
GCATCGAGATCGAGTACAACGTGCTGGCCGAGTTCATCGGCGGCGCGTGGCAGCCCGGGAACGCCTTGGCGGTGG
GAGAAAACCCGCTCTCGTACGGTTTTGTGTCATCGAGACGGCGGTGCTGACAGCGTTTACAGATGAACCTGTTCA
AGGGCTTCGGATACGTGACGGTGGCTCACGCCCTCGACTTCGCCAACGACCTGAAGCTCGGCCACTACCTGAAGA
TTCCGCCGCGCCAGACCTTTTGGTGCCAGATATGCGCCGGTAAGAAGCCCGAGGCCTGCCAGCCGAATTTGTGAA
TGTGTTGCGAACGGACATCTGATGCCGAACCCTTCTGCACAGCCGTCGTCTCGGCCTTCGTCTGTACCGGCGTCA
TGAACTTCCAGATCCTGCACATCCCCGACATCTGCGAGGCCGACCAGAAGGACAAGTTCAGCTGCCCCGGTCTCC
AGTCCTACTTCACCGCCGCCGTCCTCTTCGGCTCCCTGGGCGCGCGCAAGGTCTGGGGCGCCGGCGCCCAGTACG
TCGCCATGCTGGCCGCCTTCCCCGTCGGCCTCGTCCTGCCGCTGCTCTACTACTACGCCACGCGCGGCCTACCCA
AGAACCACTGGCTCAACAAGGTGCACCCCGTCCTCATCCTGAGCGGCGGCATCACCTGGTCGCCCTACAACCTCG
GCTACATGTGGCCGGCCGTCTTCCCCAGCTGGCTCTCCTGGGTCTACATCCGCAGGAGGTACTTCTCGCTGTGGT
CCAAGTACAACTACGTCCTGTCGGCCGCGCTCTCGACCGCCGTCGCCGTCGCCGCCGTCGTCATCTTCTTCGCCC
TGAGCTACCACGGCGTCAACCTCGACTGGGTCGGCAACAAGCCGGACAGCGGCTGCGAGGCCAAGGCCTGCACGC
GCCTGAAGCTGCCGACGGGCGAGTATTTCGGGCCCCGAATAGGCACCTACGTTTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail