Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8731
Gene name
LocationContig_59:26699..27890
Strand+
Gene length (bp)1191
Transcript length (bp)993
Coding sequence length (bp)993
Protein length (aa) 331

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04614 Pex19 Pex19 protein family 1.9E-76 93 329

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8VCI5|PEX19_MOUSE Peroxisomal biogenesis factor 19 OS=Mus musculus GN=Pex19 PE=1 SV=1 49 313 2.0E-21
sp|Q9SRQ3|PE191_ARATH Peroxisome biogenesis protein 19-1 OS=Arabidopsis thaliana GN=PEX19-1 PE=1 SV=1 163 313 3.0E-20
sp|Q9QYU1|PEX19_RAT Peroxisomal biogenesis factor 19 OS=Rattus norvegicus GN=Pex19 PE=1 SV=1 49 313 2.0E-19
sp|Q3SZD1|PEX19_BOVIN Peroxisomal biogenesis factor 19 OS=Bos taurus GN=PEX19 PE=2 SV=1 69 313 3.0E-18
sp|P40855|PEX19_HUMAN Peroxisomal biogenesis factor 19 OS=Homo sapiens GN=PEX19 PE=1 SV=1 49 313 5.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8VCI5|PEX19_MOUSE Peroxisomal biogenesis factor 19 OS=Mus musculus GN=Pex19 PE=1 SV=1 49 313 2.0E-21
sp|Q9SRQ3|PE191_ARATH Peroxisome biogenesis protein 19-1 OS=Arabidopsis thaliana GN=PEX19-1 PE=1 SV=1 163 313 3.0E-20
sp|Q9QYU1|PEX19_RAT Peroxisomal biogenesis factor 19 OS=Rattus norvegicus GN=Pex19 PE=1 SV=1 49 313 2.0E-19
sp|Q3SZD1|PEX19_BOVIN Peroxisomal biogenesis factor 19 OS=Bos taurus GN=PEX19 PE=2 SV=1 69 313 3.0E-18
sp|P40855|PEX19_HUMAN Peroxisomal biogenesis factor 19 OS=Homo sapiens GN=PEX19 PE=1 SV=1 49 313 5.0E-18
sp|Q5R7U2|PEX19_PONAB Peroxisomal biogenesis factor 19 OS=Pongo abelii GN=PEX19 PE=2 SV=1 49 313 7.0E-18
sp|Q60415|PEX19_CRIGR Peroxisomal biogenesis factor 19 OS=Cricetulus griseus GN=PEX19 PE=1 SV=1 69 313 8.0E-18
sp|Q94EI3|PE192_ARATH Peroxisome biogenesis protein 19-2 OS=Arabidopsis thaliana GN=PEX19-2 PE=1 SV=1 189 313 9.0E-18
sp|Q07418|PEX19_YEAST Peroxisomal membrane protein import receptor PEX19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX19 PE=1 SV=2 132 306 1.0E-12
sp|A6ZXR1|PEX19_YEAS7 Peroxisomal membrane protein import receptor PEX19 OS=Saccharomyces cerevisiae (strain YJM789) GN=PEX19 PE=3 SV=2 132 306 2.0E-12
sp|P34453|PEX19_CAEEL Putative peroxisomal biogenesis factor 19 OS=Caenorhabditis elegans GN=prx-19 PE=1 SV=1 122 313 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005777 peroxisome Yes
GO:0043227 membrane-bounded organelle No
GO:0043229 intracellular organelle No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0043226 organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:0044424 intracellular part No
GO:0042579 microbody No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8731
MDAKREEAGTKGPGQSVGAPTEAPSKASGVVDDVPDPDEDDLDDLDDMLDDFSTVKLDSNKAVQPPAPSAAEAKS
PDPAATEPAPPKPEESFSEDEFAKQLQAGMADLLGELEKSPEMQEQFEEMFKQMTADAAAADDAQPEQGTGASSS
TKSTGDAATDASFQDTIRRTMERMQTSGDQATAAAASDGTDDFMSEVLKQLSSGDFNPEGGEEDFSKMLMGMMEQ
LTNKDILYEPMKELDDKFPQWFEKNKDSTPAEDLKRYGEQRVLVKEIVARFEQSTYSDSNAADREYIVDRMQKMQ
AAGSPPSDLVGDMASAQEAFNSADEQCNPQ*
Coding >Hirsu2|8731
ATGGATGCGAAGAGAGAGGAGGCAGGGACCAAGGGGCCCGGTCAAAGTGTCGGTGCCCCGACCGAGGCCCCCAGC
AAGGCCTCGGGCGTCGTCGACGACGTGCCCGACCCCGACGAGGACGATTTGGACGACCTGGATGACATGCTCGAT
GATTTCTCGACCGTCAAACTCGACTCCAACAAGGCCGTTCAGCCGCCGGCGCCCAGCGCCGCCGAAGCCAAGTCG
CCGGATCCTGCTGCGACGGAGCCTGCGCCGCCGAAGCCAGAAGAGTCCTTCTCCGAGGATGAATTCGCCAAGCAG
CTGCAAGCCGGCATGGCCGACCTGCTCGGCGAGCTGGAGAAGTCGCCCGAGATGCAGGAGCAGTTCGAGGAGATG
TTCAAACAGATGACCGCCGATGCCGCCGCCGCCGACGACGCGCAGCCAGAGCAGGGCACCGGTGCCTCCAGCTCC
ACCAAGTCGACGGGCGACGCCGCCACCGACGCCTCCTTTCAAGACACCATCCGCCGCACCATGGAGCGCATGCAG
ACGTCCGGCGACCAGGCCACCGCGGCGGCCGCGTCGGACGGCACCGACGACTTCATGTCCGAGGTGCTCAAACAG
CTCTCCTCGGGCGACTTCAACCCCGAAGGCGGCGAGGAAGACTTCTCCAAGATGCTCATGGGCATGATGGAGCAG
CTGACCAACAAGGACATCCTGTACGAGCCTATGAAGGAGCTCGACGACAAGTTTCCCCAGTGGTTTGAGAAGAAC
AAGGACTCCACCCCGGCCGAGGACTTGAAACGGTACGGCGAGCAAAGAGTGCTCGTCAAGGAGATTGTCGCCAGG
TTCGAGCAGAGCACCTACTCGGACAGCAACGCCGCCGACCGGGAGTACATTGTGGACAGGATGCAGAAGATGCAA
GCAGCAGGTTCGCCGCCGTCGGACCTGGTGGGGGACATGGCGTCGGCGCAGGAGGCCTTCAACTCGGCAGACGAG
CAATGCAACCCGCAGTAG
Transcript >Hirsu2|8731
ATGGATGCGAAGAGAGAGGAGGCAGGGACCAAGGGGCCCGGTCAAAGTGTCGGTGCCCCGACCGAGGCCCCCAGC
AAGGCCTCGGGCGTCGTCGACGACGTGCCCGACCCCGACGAGGACGATTTGGACGACCTGGATGACATGCTCGAT
GATTTCTCGACCGTCAAACTCGACTCCAACAAGGCCGTTCAGCCGCCGGCGCCCAGCGCCGCCGAAGCCAAGTCG
CCGGATCCTGCTGCGACGGAGCCTGCGCCGCCGAAGCCAGAAGAGTCCTTCTCCGAGGATGAATTCGCCAAGCAG
CTGCAAGCCGGCATGGCCGACCTGCTCGGCGAGCTGGAGAAGTCGCCCGAGATGCAGGAGCAGTTCGAGGAGATG
TTCAAACAGATGACCGCCGATGCCGCCGCCGCCGACGACGCGCAGCCAGAGCAGGGCACCGGTGCCTCCAGCTCC
ACCAAGTCGACGGGCGACGCCGCCACCGACGCCTCCTTTCAAGACACCATCCGCCGCACCATGGAGCGCATGCAG
ACGTCCGGCGACCAGGCCACCGCGGCGGCCGCGTCGGACGGCACCGACGACTTCATGTCCGAGGTGCTCAAACAG
CTCTCCTCGGGCGACTTCAACCCCGAAGGCGGCGAGGAAGACTTCTCCAAGATGCTCATGGGCATGATGGAGCAG
CTGACCAACAAGGACATCCTGTACGAGCCTATGAAGGAGCTCGACGACAAGTTTCCCCAGTGGTTTGAGAAGAAC
AAGGACTCCACCCCGGCCGAGGACTTGAAACGGTACGGCGAGCAAAGAGTGCTCGTCAAGGAGATTGTCGCCAGG
TTCGAGCAGAGCACCTACTCGGACAGCAACGCCGCCGACCGGGAGTACATTGTGGACAGGATGCAGAAGATGCAA
GCAGCAGGTTCGCCGCCGTCGGACCTGGTGGGGGACATGGCGTCGGCGCAGGAGGCCTTCAACTCGGCAGACGAG
CAATGCAACCCGCAGTAG
Gene >Hirsu2|8731
ATGGATGCGAAGAGAGAGGAGGCAGGGACCAAGGGGCCCGGTCAAAGTGTCGGTGCCCCGACCGAGGCCCCCAGC
AAGGCCTCGGGCGTCGTCGACGACGTGCCCGACCCCGACGAGGACGATTTGGACGACCTGGATGGTGAGAGCGGC
CGCGTCGGTATCGGCTTGCGCGCACCTCGACTAACCGAGGCTGCACGCAGACATGCTCGATGATTTCTCGACCGT
CAAACTCGACTCCAACAAGGCCGTTCAGCCGCCGGCGCCCAGCGCCGCCGAAGCCAAGTCGCCGGATCCTGCTGC
GACGGAGCCTGCGCCGCCGAAGCCAGAAGAGTCCTTCTCCGAGGATGAATTCGCCAAGCAGCTGCAAGCCGGCAT
GGCCGACCTGCTCGGCGAGCTGGAGAAGTCGGTGAGCGAACGCCGTTGCGCGCAATGCAGGCTCCATCCGCGCGC
TGTCGCTGACCACTCGCCTCTTCCGGAAGCCCGAGATGCAGGAGCAGTTCGAGGAGATGTTCAAACAGATGACCG
CCGATGCCGCCGCCGCCGACGACGCGCAGCCAGAGCAGGGCACCGGTGCCTCCAGCTCCACCAAGTCGACGGGCG
ACGCCGCCACCGACGCCTCCTTTCAAGACACCATCCGCCGCACCATGGAGCGCATGCAGACGTCCGGCGACCAGG
CCACCGCGGCGGCCGCGTCGGACGGCACCGACGACTTCATGTCCGAGGTGCTCAAACAGCTCTCCTCGGGCGACT
TCAACCCCGAAGGCGGCGAGGAAGACTTCTCCAAGATGCTCATGGGCATGATGGAGCAGCTGACCAACAAGGACA
TCCTGTACGAGCCTATGAAGGAGCTCGACGACAAGTTTCCCCAGTGGTTTGAGAAGAACAAGGACTCCACCCCGG
CCGAGGACTTGAAACGGTACGGCGAGCAAAGAGTGCTCGTCAAGGAGATTGTCGCCAGGTTCGAGCAGAGCACCT
ACTCGGACAGCAACGCCGCCGACCGGGAGTACATTGTGGACAGGATGCAGAAGGTGAGGCGCCCCCCCCCCCCCT
TCCGCGGCGCGCAAACAGGCTTACTGACCAGATGCGGCTCAGATGCAAGCAGCAGGTTCGCCGCCGTCGGACCTG
GTGGGGGACATGGCGTCGGCGCAGGAGGCCTTCAACTCGGCAGACGAGCAATGCAACCCGCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail