Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8724
Gene name
LocationContig_589:13941..15672
Strand+
Gene length (bp)1731
Transcript length (bp)1620
Coding sequence length (bp)1620
Protein length (aa) 540

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04515 Choline_transpo Plasma-membrane choline transporter 7.7E-80 191 512

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I8E9|PNS1_GIBZE Protein PNS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PNS1 PE=3 SV=1 66 539 0.0E+00
sp|Q4WYG7|PNS1_ASPFU Protein pns1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pns1 PE=3 SV=1 16 537 0.0E+00
sp|Q870V7|PNS1_NEUCR Protein PNS1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pns-1 PE=3 SV=1 10 537 0.0E+00
sp|Q6C938|PNS1_YARLI Protein PNS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PNS1 PE=3 SV=1 5 538 2.0E-136
sp|Q12412|PNS1_YEAST Protein PNS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PNS1 PE=1 SV=1 31 537 4.0E-120
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I8E9|PNS1_GIBZE Protein PNS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PNS1 PE=3 SV=1 66 539 0.0E+00
sp|Q4WYG7|PNS1_ASPFU Protein pns1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pns1 PE=3 SV=1 16 537 0.0E+00
sp|Q870V7|PNS1_NEUCR Protein PNS1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pns-1 PE=3 SV=1 10 537 0.0E+00
sp|Q6C938|PNS1_YARLI Protein PNS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PNS1 PE=3 SV=1 5 538 2.0E-136
sp|Q12412|PNS1_YEAST Protein PNS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PNS1 PE=1 SV=1 31 537 4.0E-120
sp|Q5AB93|PNS1_CANAL Protein PNS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PNS1 PE=3 SV=1 35 536 5.0E-120
sp|Q75EG5|PNS1_ASHGO Protein PNS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PNS1 PE=3 SV=1 27 537 5.0E-120
sp|Q6BIV4|PNS1_DEBHA Protein PNS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PNS1 PE=3 SV=2 33 536 4.0E-119
sp|Q6FLC9|PNS1_CANGA Protein PNS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PNS1 PE=3 SV=1 4 536 5.0E-113
sp|Q6CY85|PNS1_KLULA Protein PNS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PNS1 PE=3 SV=1 6 537 3.0E-111
sp|P0CM92|PNS1_CRYNJ Protein PNS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PNS1 PE=3 SV=1 31 536 1.0E-92
sp|P0CM93|PNS1_CRYNB Protein PNS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PNS1 PE=3 SV=1 31 536 1.0E-92
sp|Q4PIP8|PNS1_USTMA Protein PNS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PNS1 PE=3 SV=2 7 537 2.0E-88
sp|Q869R1|CTLHB_DICDI CTL-like protein DDB_G0274487 OS=Dictyostelium discoideum GN=DDB_G0274487 PE=3 SV=1 64 523 5.0E-38
sp|Q54IJ2|CTLHA_DICDI CTL-like protein DDB_G0288717 OS=Dictyostelium discoideum GN=DDB_G0288717 PE=3 SV=1 81 539 2.0E-24
sp|A8XKF2|CTL1L_CAEBR Choline transporter-like protein 1 OS=Caenorhabditis briggsae GN=chtl-1 PE=3 SV=2 268 512 2.0E-13
sp|Q20026|CTL1L_CAEEL Choline transporter-like protein 1 OS=Caenorhabditis elegans GN=chtl-1 PE=3 SV=1 284 512 8.0E-13
sp|B0JZD0|CTL5_XENTR Choline transporter-like protein 5 OS=Xenopus tropicalis GN=slc44a5 PE=2 SV=1 304 512 2.0E-12
sp|Q55CN8|CTLHC_DICDI CTL-like protein DDB_G0269978 OS=Dictyostelium discoideum GN=DDB_G0269978 PE=3 SV=1 60 427 5.0E-12
sp|Q8BY89|CTL2_MOUSE Choline transporter-like protein 2 OS=Mus musculus GN=Slc44a2 PE=1 SV=2 141 448 1.0E-10
sp|Q5RJI2|CTL5_MOUSE Choline transporter-like protein 5 OS=Mus musculus GN=Slc44a5 PE=2 SV=1 272 510 2.0E-10
sp|A5PMW0|CTL5A_DANRE Choline transporter-like protein 5-A (Fragment) OS=Danio rerio GN=slc44a5a PE=3 SV=1 299 512 2.0E-10
sp|A3KMY4|CTL4_BOVIN Choline transporter-like protein 4 OS=Bos taurus GN=SLC44A4 PE=2 SV=1 275 510 2.0E-10
sp|Q95JW2|CTL5_MACFA Choline transporter-like protein 5 OS=Macaca fascicularis GN=SLC44A5 PE=2 SV=1 180 512 2.0E-10
sp|A5D7H3|CTL2_BOVIN Choline transporter-like protein 2 OS=Bos taurus GN=SLC44A2 PE=2 SV=1 272 512 3.0E-10
sp|B4F795|CTL2_RAT Choline transporter-like protein 2 OS=Rattus norvegicus GN=Slc44a2 PE=2 SV=1 184 448 3.0E-10
sp|Q7SYC9|CTL2_DANRE Choline transporter-like protein 2 OS=Danio rerio GN=slc44a2 PE=2 SV=1 281 535 4.0E-10
sp|Q91VA1|CTL4_MOUSE Choline transporter-like protein 4 OS=Mus musculus GN=Slc44a4 PE=1 SV=1 275 510 4.0E-10
sp|Q8NCS7|CTL5_HUMAN Choline transporter-like protein 5 OS=Homo sapiens GN=SLC44A5 PE=2 SV=4 180 512 8.0E-10
sp|Q53GD3|CTL4_HUMAN Choline transporter-like protein 4 OS=Homo sapiens GN=SLC44A4 PE=2 SV=2 270 510 8.0E-10
sp|Q6MG71|CTL4_RAT Choline transporter-like protein 4 OS=Rattus norvegicus GN=Slc44a4 PE=2 SV=1 270 510 1.0E-09
sp|Q6IP59|CTL2_XENLA Choline transporter-like protein 2 OS=Xenopus laevis GN=slc44a2 PE=2 SV=1 141 448 1.0E-09
sp|Q7PRJ0|CTLH2_ANOGA CTL-like protein 2 OS=Anopheles gambiae GN=AGAP010343 PE=3 SV=4 307 510 1.0E-09
sp|F1S584|CTL2_PIG Choline transporter-like protein 2 OS=Sus scrofa GN=SLC44A2 PE=3 SV=1 272 448 2.0E-09
sp|Q54I48|CTL2_DICDI Choline transporter-like protein 2 OS=Dictyostelium discoideum GN=slc44a2 PE=3 SV=1 304 512 2.0E-09
sp|Q810F1|CTL2_CAVPO Choline transporter-like protein 2 OS=Cavia porcellus GN=SLC44A2 PE=1 SV=1 273 459 2.0E-09
sp|B0S5A7|CTL5B_DANRE Choline transporter-like protein 5-B (Fragment) OS=Danio rerio GN=slc44a5b PE=3 SV=1 299 512 3.0E-09
sp|A5PF08|CTL4_PIG Choline transporter-like protein 4 OS=Sus scrofa GN=SLC44A4 PE=3 SV=1 280 510 3.0E-09
sp|Q7T2B0|CTL4_DANRE Choline transporter-like protein 4 OS=Danio rerio GN=slc44a4 PE=2 SV=1 304 448 5.0E-09
sp|Q6GN42|CTL4_XENLA Choline transporter-like protein 4 OS=Xenopus laevis GN=slc44a4 PE=2 SV=1 304 512 6.0E-09
sp|Q8IWA5|CTL2_HUMAN Choline transporter-like protein 2 OS=Homo sapiens GN=SLC44A2 PE=1 SV=3 273 448 8.0E-09
sp|Q5R5L9|CTL2_PONAB Choline transporter-like protein 2 OS=Pongo abelii GN=SLC44A2 PE=2 SV=1 273 459 1.0E-08
sp|Q8WWI5|CTL1_HUMAN Choline transporter-like protein 1 OS=Homo sapiens GN=SLC44A1 PE=1 SV=1 287 512 1.0E-07
sp|Q9VAP3|CTLH2_DROME CTL-like protein 2 OS=Drosophila melanogaster GN=CG11880 PE=3 SV=1 285 423 2.0E-07
sp|B5X3W7|CTL2_SALSA Choline transporter-like protein 2 OS=Salmo salar GN=slc44a2 PE=2 SV=1 184 459 2.0E-07
sp|Q8VII6|CTL1_RAT Choline transporter-like protein 1 OS=Rattus norvegicus GN=Slc44a1 PE=1 SV=1 287 512 5.0E-07
sp|Q6X893|CTL1_MOUSE Choline transporter-like protein 1 OS=Mus musculus GN=Slc44a1 PE=1 SV=3 287 512 5.0E-07
sp|Q7Q5R7|CTLH1_ANOGA CTL-like protein 1 OS=Anopheles gambiae GN=AGAP006244 PE=3 SV=4 296 513 6.0E-07
sp|Q17JQ7|CTLH1_AEDAE CTL-like protein 1 OS=Aedes aegypti GN=AAEL001935 PE=3 SV=1 296 513 1.0E-06
sp|Q6IR74|CTL1_XENLA Choline transporter-like protein 1 OS=Xenopus laevis GN=slc44a1 PE=2 SV=2 287 512 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

Domain # Start End Length
1 85 107 22
2 133 155 22
3 162 181 19
4 185 207 22
5 228 250 22
6 281 299 18
7 333 355 22
8 370 392 22
9 440 462 22
10 477 499 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8724
MGEWGGQSAPQQQYYGQQPQYGQPPQQYGQPPHGQYPQYGQHPDGYNSYPQEPPPQYSFHPPQPNDDKYTFDSAF
KVQKPKYNDVWAGILLILVFCGYVVISAVTINGAFFANGRPGRGIYDNSNDFSLNSNTIILFAFVLVVALVFSYA
YVWLARIFPKQFIWLTGILNICWALGTALFYLYKRYWSAGIVFLIMAVFTIVAFLSWRSRIPFSALMLKTTITVS
KRYGHVYLVSLLGGLVAIAFSAWYAVTLVAIYVRYQPARDNPQCGPGGGGCGRGKVIGLIVYVTFAMYFLSEWIK
YTIHATIAGVYGSWYFSPHNFPKAATRGAARRALTYGFGSISLGSLLIAIVQFLRQICSVARSQAADDGGIGGIV
LYVVFCLLSCLLGLLEWMVEFVNRYSIVAVALYNKAYFPAAKDTWKMIKDRGIDALVQQCLIGPVLSFGALFIAL
ACTLFSYLYLILTKPQYNADGGYTPFVLAFAFLIGFQIANIFTTPLSSGIDTLFVAMGWDPQILISEHPELFQEM
VRVYPQVQQAIQLR*
Coding >Hirsu2|8724
ATGGGTGAATGGGGAGGCCAGTCTGCGCCGCAGCAGCAGTACTACGGCCAGCAGCCTCAGTACGGCCAGCCGCCG
CAGCAGTACGGCCAGCCGCCGCATGGCCAGTATCCGCAGTACGGCCAGCATCCGGACGGCTACAACAGCTACCCG
CAAGAACCGCCGCCGCAGTATAGCTTCCACCCGCCCCAGCCCAACGACGACAAGTACACCTTCGACTCGGCCTTC
AAGGTCCAGAAGCCCAAGTACAACGATGTCTGGGCCGGCATCCTGCTCATCCTCGTCTTTTGCGGCTATGTCGTC
ATCTCCGCCGTCACCATCAACGGCGCCTTCTTCGCCAACGGCAGGCCCGGCCGCGGCATCTACGACAACAGCAAC
GACTTCTCGCTCAACTCCAACACCATCATCCTCTTCGCCTTCGTCCTCGTCGTCGCCCTCGTCTTCTCCTACGCC
TACGTCTGGCTAGCCCGCATCTTCCCCAAGCAGTTCATCTGGCTGACGGGCATCCTCAACATCTGCTGGGCCCTC
GGCACCGCCCTCTTCTACCTCTACAAGAGGTACTGGTCCGCCGGCATCGTCTTCCTCATCATGGCCGTCTTCACC
ATCGTCGCCTTCCTGTCCTGGCGCTCGCGCATCCCCTTCTCCGCCCTGATGCTCAAGACGACCATCACCGTCAGC
AAGCGCTACGGCCACGTCTACCTCGTCAGCCTGCTCGGCGGCCTGGTCGCCATCGCCTTCTCGGCCTGGTACGCC
GTCACGCTCGTCGCCATCTACGTCCGCTACCAGCCCGCCCGCGACAACCCGCAGTGCGGCCCCGGCGGCGGCGGC
TGCGGCCGGGGCAAGGTCATCGGCCTCATCGTCTACGTCACCTTCGCCATGTACTTCCTGTCCGAGTGGATCAAG
TACACCATCCACGCCACCATCGCCGGCGTCTACGGCTCCTGGTACTTCAGCCCGCACAACTTCCCCAAGGCCGCC
ACCCGCGGCGCCGCCCGCCGCGCCCTCACCTACGGCTTCGGCTCCATCAGCCTCGGCAGCCTGCTCATCGCCATC
GTCCAGTTCCTGCGCCAGATCTGCTCCGTCGCCCGCAGCCAGGCCGCCGACGACGGCGGCATCGGCGGCATCGTC
CTCTACGTCGTCTTCTGCCTGCTCTCGTGCCTGCTGGGCCTGCTCGAGTGGATGGTCGAGTTCGTCAACCGCTAC
TCCATCGTCGCCGTCGCCCTCTACAACAAGGCCTACTTCCCCGCCGCCAAGGACACGTGGAAGATGATCAAGGAC
CGCGGCATCGACGCCCTGGTCCAGCAGTGCCTCATCGGGCCCGTCCTCTCCTTCGGCGCCCTCTTCATCGCCCTC
GCCTGCACCCTCTTCTCCTACCTCTACCTCATCCTGACCAAGCCCCAGTACAACGCCGACGGCGGCTACACCCCC
TTCGTCCTCGCCTTCGCCTTCCTCATCGGCTTCCAGATCGCAAACATCTTCACCACGCCCCTGTCGAGCGGCATC
GACACCCTCTTCGTCGCCATGGGCTGGGACCCGCAGATCCTCATCTCCGAGCACCCGGAGCTGTTCCAGGAGATG
GTGCGCGTCTACCCGCAGGTCCAGCAGGCCATCCAGCTGCGCTGA
Transcript >Hirsu2|8724
ATGGGTGAATGGGGAGGCCAGTCTGCGCCGCAGCAGCAGTACTACGGCCAGCAGCCTCAGTACGGCCAGCCGCCG
CAGCAGTACGGCCAGCCGCCGCATGGCCAGTATCCGCAGTACGGCCAGCATCCGGACGGCTACAACAGCTACCCG
CAAGAACCGCCGCCGCAGTATAGCTTCCACCCGCCCCAGCCCAACGACGACAAGTACACCTTCGACTCGGCCTTC
AAGGTCCAGAAGCCCAAGTACAACGATGTCTGGGCCGGCATCCTGCTCATCCTCGTCTTTTGCGGCTATGTCGTC
ATCTCCGCCGTCACCATCAACGGCGCCTTCTTCGCCAACGGCAGGCCCGGCCGCGGCATCTACGACAACAGCAAC
GACTTCTCGCTCAACTCCAACACCATCATCCTCTTCGCCTTCGTCCTCGTCGTCGCCCTCGTCTTCTCCTACGCC
TACGTCTGGCTAGCCCGCATCTTCCCCAAGCAGTTCATCTGGCTGACGGGCATCCTCAACATCTGCTGGGCCCTC
GGCACCGCCCTCTTCTACCTCTACAAGAGGTACTGGTCCGCCGGCATCGTCTTCCTCATCATGGCCGTCTTCACC
ATCGTCGCCTTCCTGTCCTGGCGCTCGCGCATCCCCTTCTCCGCCCTGATGCTCAAGACGACCATCACCGTCAGC
AAGCGCTACGGCCACGTCTACCTCGTCAGCCTGCTCGGCGGCCTGGTCGCCATCGCCTTCTCGGCCTGGTACGCC
GTCACGCTCGTCGCCATCTACGTCCGCTACCAGCCCGCCCGCGACAACCCGCAGTGCGGCCCCGGCGGCGGCGGC
TGCGGCCGGGGCAAGGTCATCGGCCTCATCGTCTACGTCACCTTCGCCATGTACTTCCTGTCCGAGTGGATCAAG
TACACCATCCACGCCACCATCGCCGGCGTCTACGGCTCCTGGTACTTCAGCCCGCACAACTTCCCCAAGGCCGCC
ACCCGCGGCGCCGCCCGCCGCGCCCTCACCTACGGCTTCGGCTCCATCAGCCTCGGCAGCCTGCTCATCGCCATC
GTCCAGTTCCTGCGCCAGATCTGCTCCGTCGCCCGCAGCCAGGCCGCCGACGACGGCGGCATCGGCGGCATCGTC
CTCTACGTCGTCTTCTGCCTGCTCTCGTGCCTGCTGGGCCTGCTCGAGTGGATGGTCGAGTTCGTCAACCGCTAC
TCCATCGTCGCCGTCGCCCTCTACAACAAGGCCTACTTCCCCGCCGCCAAGGACACGTGGAAGATGATCAAGGAC
CGCGGCATCGACGCCCTGGTCCAGCAGTGCCTCATCGGGCCCGTCCTCTCCTTCGGCGCCCTCTTCATCGCCCTC
GCCTGCACCCTCTTCTCCTACCTCTACCTCATCCTGACCAAGCCCCAGTACAACGCCGACGGCGGCTACACCCCC
TTCGTCCTCGCCTTCGCCTTCCTCATCGGCTTCCAGATCGCAAACATCTTCACCACGCCCCTGTCGAGCGGCATC
GACACCCTCTTCGTCGCCATGGGCTGGGACCCGCAGATCCTCATCTCCGAGCACCCGGAGCTGTTCCAGGAGATG
GTGCGCGTCTACCCGCAGGTCCAGCAGGCCATCCAGCTGCGCTGA
Gene >Hirsu2|8724
ATGGGTGAATGGGGAGGCCAGTCTGCGCCGCAGCAGCAGTACTACGGCCAGCAGCCTCAGTACGGCCAGCCGCCG
CAGCAGTACGGCCAGCCGCCGCATGGCCAGTATCCGCAGTACGGCCAGCATCCGGACGGCTACAACAGCTACCCG
CAAGAACCGCCGCCGCAGTATAGCTTCCACCCGCCCCAGCCCAACGACGACAAGTACACCTTCGACTCGGCCTTC
AAGGTCCAGAAGCCCAAGTACAACGATGTCTGGGCCGGCATCCTGGTAGGACGCGCCTCCCGACCCCCGTCTCCT
CCTCTGCCCGTCCTCTTCCCCTCCCTCCCCCCTCTGTCGATGCTACCAAGCCGGAAAACACGTTGCTGAGGCGCG
GCGCAGCTCATCCTCGTCTTTTGCGGCTATGTCGTCATCTCCGCCGTCACCATCAACGGCGCCTTCTTCGCCAAC
GGCAGGCCCGGCCGCGGCATCTACGACAACAGCAACGACTTCTCGCTCAACTCCAACACCATCATCCTCTTCGCC
TTCGTCCTCGTCGTCGCCCTCGTCTTCTCCTACGCCTACGTCTGGCTAGCCCGCATCTTCCCCAAGCAGTTCATC
TGGCTGACGGGCATCCTCAACATCTGCTGGGCCCTCGGCACCGCCCTCTTCTACCTCTACAAGAGGTACTGGTCC
GCCGGCATCGTCTTCCTCATCATGGCCGTCTTCACCATCGTCGCCTTCCTGTCCTGGCGCTCGCGCATCCCCTTC
TCCGCCCTGATGCTCAAGACGACCATCACCGTCAGCAAGCGCTACGGCCACGTCTACCTCGTCAGCCTGCTCGGC
GGCCTGGTCGCCATCGCCTTCTCGGCCTGGTACGCCGTCACGCTCGTCGCCATCTACGTCCGCTACCAGCCCGCC
CGCGACAACCCGCAGTGCGGCCCCGGCGGCGGCGGCTGCGGCCGGGGCAAGGTCATCGGCCTCATCGTCTACGTC
ACCTTCGCCATGTACTTCCTGTCCGAGTGGATCAAGTACACCATCCACGCCACCATCGCCGGCGTCTACGGCTCC
TGGTACTTCAGCCCGCACAACTTCCCCAAGGCCGCCACCCGCGGCGCCGCCCGCCGCGCCCTCACCTACGGCTTC
GGCTCCATCAGCCTCGGCAGCCTGCTCATCGCCATCGTCCAGTTCCTGCGCCAGATCTGCTCCGTCGCCCGCAGC
CAGGCCGCCGACGACGGCGGCATCGGCGGCATCGTCCTCTACGTCGTCTTCTGCCTGCTCTCGTGCCTGCTGGGC
CTGCTCGAGTGGATGGTCGAGTTCGTCAACCGCTACTCCATCGTCGCCGTCGCCCTCTACAACAAGGCCTACTTC
CCCGCCGCCAAGGACACGTGGAAGATGATCAAGGACCGCGGCATCGACGCCCTGGTCCAGCAGTGCCTCATCGGG
CCCGTCCTCTCCTTCGGCGCCCTCTTCATCGCCCTCGCCTGCACCCTCTTCTCCTACCTCTACCTCATCCTGACC
AAGCCCCAGTACAACGCCGACGGCGGCTACACCCCCTTCGTCCTCGCCTTCGCCTTCCTCATCGGCTTCCAGATC
GCAAACATCTTCACCACGCCCCTGTCGAGCGGCATCGACACCCTCTTCGTCGCCATGGGCTGGGACCCGCAGATC
CTCATCTCCGAGCACCCGGAGCTGTTCCAGGAGATGGTGCGCGTCTACCCGCAGGTCCAGCAGGCCATCCAGCTG
CGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail