Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8717
Gene name
LocationContig_588:12712..13423
Strand+
Gene length (bp)711
Transcript length (bp)351
Coding sequence length (bp)351
Protein length (aa) 117

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03669 UPF0139 Uncharacterised protein family (UPF0139) 1.8E-06 5 91

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12160|YP063_YEAST Uncharacterized protein YPR063C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR063C PE=1 SV=1 5 107 6.0E-11
sp|Q09714|YA38_SCHPO Uncharacterized protein C18B11.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC18B11.08c PE=4 SV=2 1 95 2.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

Domain # Start End Length
1 76 95 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8717
MAPGKDMRRPDLIVPYQEPAGSGDKADFSSTLASTMPMAAMFTRNKFVGWAAVVVSIQNWLGESDEARKSSSTPG
YFSILMSLMALGVTYMPMFLPPRAVPAGSGTEAAPPPVPPQ*
Coding >Hirsu2|8717
ATGGCGCCCGGCAAGGACATGCGACGGCCCGACCTGATCGTCCCGTACCAGGAACCGGCCGGGTCGGGCGACAAG
GCCGACTTCTCCTCCACGCTTGCGTCGACGATGCCCATGGCTGCCATGTTCACGCGTAACAAGTTTGTCGGGTGG
GCCGCCGTCGTCGTTTCCATCCAGAACTGGCTCGGCGAGAGCGACGAGGCGAGGAAGAGCTCGAGCACGCCGGGC
TACTTCTCCATTCTCATGTCACTCATGGCTCTGGGCGTCACCTACATGCCCATGTTCCTGCCGCCAAGGGCGGTC
CCCGCTGGCTCAGGCACCGAGGCGGCGCCGCCGCCGGTTCCCCCGCAGTGA
Transcript >Hirsu2|8717
ATGGCGCCCGGCAAGGACATGCGACGGCCCGACCTGATCGTCCCGTACCAGGAACCGGCCGGGTCGGGCGACAAG
GCCGACTTCTCCTCCACGCTTGCGTCGACGATGCCCATGGCTGCCATGTTCACGCGTAACAAGTTTGTCGGGTGG
GCCGCCGTCGTCGTTTCCATCCAGAACTGGCTCGGCGAGAGCGACGAGGCGAGGAAGAGCTCGAGCACGCCGGGC
TACTTCTCCATTCTCATGTCACTCATGGCTCTGGGCGTCACCTACATGCCCATGTTCCTGCCGCCAAGGGCGGTC
CCCGCTGGCTCAGGCACCGAGGCGGCGCCGCCGCCGGTTCCCCCGCAGTGA
Gene >Hirsu2|8717
ATGGCGCCCGGCAAGGACATGCGACGGCCCGACCTGAGTGAGTCCCCTCTCCGCCCGCCCCCACCTTTCCGGTCT
CTCGCGCGGCTGGCCGTGGCGCAAGGGGGGGGGAACAGAGCTTGACGAAGATGGAGAAGATGCGGCGACGGGGAG
TCAATGCCATAAGAGGCCGAGCCATCTGTCCATCCATGCTGACGGTTGTCATGCGACTCTTCCCCGCACAGTCGT
CCCGTACCAGGAACCGGCCGGGTCGGGCGACAAGGCCGACTTCTCCTCCACGCTTGCGTCGACGATGCCCATGGC
TGCCATGTTCACGCGTAACAAGTTTGTCGGGTGGTAGGCGTGTTTCCTCCTCTCCCTCTCACGGATGGCGGGGGA
CGATACGGGGGAGATGAGAGAGAGACAGATGAATGCCGGGGCTTGGGCTGACCACACGCGCGCCGGGACCCAGGG
CCGCCGTCGTCGTTTCCATCCAGAACTGGCTCGGCGAGAGCGACGAGGCGAGGAAGAGCTCGAGCACGCCGGGCT
ACTTCTCCATTCTCATGTCACGTACGGCTTCCTGACGGCTCCGGGCTCGGACGGTCTGCGGATTCGCTGATGGCG
GTTGCAGTCATGGCTCTGGGCGTCACCTACATGCCCATGTTCCTGCCGCCAAGGGCGGTCCCCGCTGGCTCAGGC
ACCGAGGCGGCGCCGCCGCCGGTTCCCCCGCAGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail