Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8708
Gene name
LocationContig_587:84..941
Strand+
Gene length (bp)857
Transcript length (bp)678
Coding sequence length (bp)678
Protein length (aa) 226

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08045 CDC14 Cell division control protein 14, SIN component 1.0E-107 1 220

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P36589|CDC14_SCHPO Cell division control protein 14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc14 PE=1 SV=1 10 223 2.0E-21

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8708
LSQDPAFREFFKLQEGFEWNVALRLIGTLDRLMAKGSDGQNDLLILSALDLIQGLLLLHPPSKSLFAREQNMNLL
LDLLEPFNCPAIQSATLLTLVVALLDTPVNTRTFEALDGLLTVTSLFKSRSTTREVKLKLVEFLYCYLMPETPSI
PRAGQRDSVPAMLQRSPSKLVGAFAGDTRRKKVSGGAVMTLTTEEKQELLSRHLSSVEDLVKDLRNCAPFGGVVC
*
Coding >Hirsu2|8708
CTGTCGCAGGACCCGGCCTTTCGCGAGTTCTTCAAGCTGCAGGAGGGCTTCGAGTGGAACGTGGCCCTGCGGCTG
ATCGGCACCCTCGATCGCCTGATGGCCAAGGGCAGCGACGGCCAGAACGACCTCCTCATCCTCAGCGCCCTCGAC
CTGATCCAGGGCCTGCTGCTGCTTCACCCGCCGAGCAAGTCGCTGTTCGCGCGCGAGCAAAACATGAACCTCCTC
CTCGACCTCCTCGAGCCCTTCAACTGCCCTGCCATCCAGTCCGCCACGCTGCTGACGCTCGTCGTCGCCCTGCTC
GACACGCCCGTCAACACGCGCACCTTCGAGGCGCTCGACGGCCTGCTGACCGTCACCTCGCTCTTCAAGTCGCGC
TCGACGACGCGCGAGGTCAAGCTCAAGCTGGTCGAGTTCCTCTACTGCTACCTCATGCCCGAGACGCCCTCGATC
CCGCGCGCCGGCCAGCGCGACTCGGTCCCGGCCATGCTCCAGCGCAGTCCTAGCAAGCTGGTCGGAGCCTTCGCC
GGCGACACGAGGCGCAAGAAGGTCAGCGGCGGCGCCGTCATGACGCTCACGACGGAGGAGAAGCAGGAGCTGCTG
AGTCGCCACCTTAGCAGCGTCGAAGACCTGGTCAAGGACCTGCGCAACTGTGCTCCCTTTGGCGGCGTCGTCTGT
TGA
Transcript >Hirsu2|8708
CTGTCGCAGGACCCGGCCTTTCGCGAGTTCTTCAAGCTGCAGGAGGGCTTCGAGTGGAACGTGGCCCTGCGGCTG
ATCGGCACCCTCGATCGCCTGATGGCCAAGGGCAGCGACGGCCAGAACGACCTCCTCATCCTCAGCGCCCTCGAC
CTGATCCAGGGCCTGCTGCTGCTTCACCCGCCGAGCAAGTCGCTGTTCGCGCGCGAGCAAAACATGAACCTCCTC
CTCGACCTCCTCGAGCCCTTCAACTGCCCTGCCATCCAGTCCGCCACGCTGCTGACGCTCGTCGTCGCCCTGCTC
GACACGCCCGTCAACACGCGCACCTTCGAGGCGCTCGACGGCCTGCTGACCGTCACCTCGCTCTTCAAGTCGCGC
TCGACGACGCGCGAGGTCAAGCTCAAGCTGGTCGAGTTCCTCTACTGCTACCTCATGCCCGAGACGCCCTCGATC
CCGCGCGCCGGCCAGCGCGACTCGGTCCCGGCCATGCTCCAGCGCAGTCCTAGCAAGCTGGTCGGAGCCTTCGCC
GGCGACACGAGGCGCAAGAAGGTCAGCGGCGGCGCCGTCATGACGCTCACGACGGAGGAGAAGCAGGAGCTGCTG
AGTCGCCACCTTAGCAGCGTCGAAGACCTGGTCAAGGACCTGCGCAACTGTGCTCCCTTTGGCGGCGTCGTCTGT
TGA
Gene >Hirsu2|8708
CTGTCGCAGGACCCGGCCTTTCGCGAGTTCTTCAAGCTGCAGGAGGGCTTCGAGTGGAACGTGGCCCTGCGGCTG
ATCGGCACCCTCGATCGCCTGATGGCCAAGGGCAGCGACGGCCAGAACGACCTCCTCATCCTCAGCGCCCTCGAC
CTGATCCAGGGCCTGCTGCTGCTTCACCCGCCGAGCAAGTCGCTGTTCGCGCGCGAGCAAAACATGAACGTTTGT
CCTCCCTCCCCTTCCCCCATCTTGTCCTACCCCCCTCTGGGAACCCCTCTGGCTTCCCTCTTCCCTCCTCCTGCT
TTCCCGAGTGGGAGGTCTTCCCATTCGTTGCGCAAAAGGGGCGCTTTGGCTGACAGCAAGACTCCCGACGACGGT
GAATCCCGGACCGCCGGCCACAGCTCCTCCTCGACCTCCTCGAGCCCTTCAACTGCCCTGCCATCCAGTCCGCCA
CGCTGCTGACGCTCGTCGTCGCCCTGCTCGACACGCCCGTCAACACGCGCACCTTCGAGGCGCTCGACGGCCTGC
TGACCGTCACCTCGCTCTTCAAGTCGCGCTCGACGACGCGCGAGGTCAAGCTCAAGCTGGTCGAGTTCCTCTACT
GCTACCTCATGCCCGAGACGCCCTCGATCCCGCGCGCCGGCCAGCGCGACTCGGTCCCGGCCATGCTCCAGCGCA
GTCCTAGCAAGCTGGTCGGAGCCTTCGCCGGCGACACGAGGCGCAAGAAGGTCAGCGGCGGCGCCGTCATGACGC
TCACGACGGAGGAGAAGCAGGAGCTGCTGAGTCGCCACCTTAGCAGCGTCGAAGACCTGGTCAAGGACCTGCGCA
ACTGTGCTCCCTTTGGCGGCGTCGTCTGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail