Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8705
Gene name
LocationContig_586:4138..5989
Strand-
Gene length (bp)1851
Transcript length (bp)1851
Coding sequence length (bp)1851
Protein length (aa) 617

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05686 Glyco_transf_90 Glycosyl transferase family 90 1.2E-14 486 599

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5K8R6|CXT1_CRYNJ Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CXT1 PE=1 SV=1 45 605 3.0E-46
sp|Q6UW63|KDEL1_HUMAN KDEL motif-containing protein 1 OS=Homo sapiens GN=KDELC1 PE=1 SV=1 492 598 1.0E-08
sp|Q29AU6|RUMI_DROPS O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura GN=rumi PE=3 SV=1 461 614 2.0E-08
sp|Q9JHP7|KDEL1_MOUSE KDEL motif-containing protein 1 OS=Mus musculus GN=Kdelc1 PE=1 SV=1 492 598 3.0E-08
sp|G3V9D0|PGLT1_RAT Protein O-glucosyltransferase 1 OS=Rattus norvegicus GN=Poglut1 PE=3 SV=1 483 605 6.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5K8R6|CXT1_CRYNJ Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CXT1 PE=1 SV=1 45 605 3.0E-46
sp|Q6UW63|KDEL1_HUMAN KDEL motif-containing protein 1 OS=Homo sapiens GN=KDELC1 PE=1 SV=1 492 598 1.0E-08
sp|Q29AU6|RUMI_DROPS O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura GN=rumi PE=3 SV=1 461 614 2.0E-08
sp|Q9JHP7|KDEL1_MOUSE KDEL motif-containing protein 1 OS=Mus musculus GN=Kdelc1 PE=1 SV=1 492 598 3.0E-08
sp|G3V9D0|PGLT1_RAT Protein O-glucosyltransferase 1 OS=Rattus norvegicus GN=Poglut1 PE=3 SV=1 483 605 6.0E-07
sp|B0X1Q4|RUMI_CULQU O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus GN=CPIJ013394 PE=3 SV=1 483 605 6.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 13 30 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8705
MPLLTRRSIFKRVSFLSALVLLFLLLRALAPDLGLRLRRPTEGRTRNGSAAGRHPIDGLTGDARLDFEAVLGKRS
ATLEQAVARYLERRGRRPPPGFGDWYAAAAGSRAVVVEDFFDRIYHDVAPLWALDPRQLRARARGQASVIRVRRG
RVERVAPAGDLSSHRLEQWARLVGEMAPHVPDLDMAVNTMDESRVLVPWEDMGRYVAEERRRRRIVGAAEAVRSH
GRDLGDEENSTRTEATRWITDEPGKYWDHLARACPPESPARTASSLTSLGGAVEYPERPVPAYTHRGFVRNFTAS
QDPCWQPHLRGMHGTFVESVSMSTTHELVPLFGESKLPRNNELLIPAAVYLDQGRAEYSGGSSHGGRWARKKDAM
VWRGAASGGRHKRDNWRRMHRSRFVRMLNGTAVASVEDGDEDPAAATFRLPSAGLYPVAARDRGRLGPWVSTWAD
VGFVEALCDPPEDVETAKQSRFCTWLRPWFSVADPVPMKEQYGYKYLPDIDGNSFSGRYRAFLLSTSLPLKATIY
AEWHDDRLFPWVHFVPMDNSFMDVYALMDYFLRGHDAEARKIAADGKSWAEAVLRREDMKLYVWRLLLEYARVVD
DDRDRLAFVEDAGEHS*
Coding >Hirsu2|8705
ATGCCTCTCCTCACCAGGCGGAGTATATTCAAAAGGGTTTCCTTCCTGTCGGCCCTCGTCCTGCTCTTTCTTTTG
CTTCGAGCCCTGGCCCCCGACTTGGGCTTGCGCCTGCGCCGTCCGACGGAGGGCAGGACGCGGAACGGCTCGGCG
GCGGGCCGCCACCCGATCGACGGCCTGACCGGCGACGCTCGGCTCGACTTCGAGGCCGTGCTGGGCAAGCGCTCG
GCCACGCTGGAGCAGGCGGTCGCGCGCTACCTGGAGCGTCGCGGCCGCCGGCCGCCGCCCGGGTTCGGCGACTGG
TACGCGGCGGCGGCGGGCAGCCGGGCCGTCGTCGTCGAGGACTTCTTCGACCGCATCTACCACGACGTGGCGCCG
CTGTGGGCTCTCGACCCGCGGCAGCTGCGCGCCCGGGCCCGCGGCCAGGCCAGCGTCATCCGCGTCCGGCGCGGC
AGGGTCGAGCGCGTCGCCCCGGCCGGCGACCTGTCGTCGCATCGGCTCGAGCAGTGGGCGAGGCTGGTGGGGGAG
ATGGCGCCGCACGTGCCCGACCTCGACATGGCCGTCAACACCATGGACGAGTCGCGCGTGCTCGTCCCGTGGGAG
GACATGGGGCGGTACGTGGCCGAGGAGCGGCGGCGGCGGCGGATCGTCGGCGCCGCCGAGGCCGTCCGCAGCCAC
GGCCGCGACTTGGGCGACGAGGAGAACTCGACGCGGACCGAGGCGACGCGTTGGATCACGGACGAGCCGGGCAAG
TACTGGGATCACCTGGCCAGGGCGTGCCCGCCGGAGAGCCCGGCGCGCACGGCGTCGTCGCTGACGTCGTTGGGC
GGGGCCGTCGAGTACCCCGAGCGGCCGGTGCCGGCGTACACGCACCGCGGCTTCGTCCGGAACTTCACGGCGTCG
CAGGACCCGTGCTGGCAGCCGCACCTGCGCGGCATGCACGGCACCTTCGTCGAGAGCGTCAGCATGTCGACGACG
CACGAGCTCGTCCCCCTGTTCGGCGAGTCCAAGCTGCCGCGCAACAACGAGCTCCTCATCCCGGCGGCCGTCTAC
CTCGACCAAGGCCGGGCCGAATACAGCGGCGGCTCCTCGCACGGCGGCCGCTGGGCGCGCAAGAAGGACGCCATG
GTCTGGCGGGGCGCCGCGTCGGGCGGGCGCCACAAGAGGGACAACTGGCGGCGCATGCACCGGAGCCGCTTCGTG
CGGATGCTCAACGGCACGGCCGTCGCGTCGGTGGAGGACGGCGACGAGGACCCGGCCGCCGCCACCTTCCGCCTC
CCCTCCGCCGGACTGTACCCCGTCGCGGCCCGAGACCGGGGCCGGCTCGGCCCGTGGGTGTCGACCTGGGCCGAC
GTCGGCTTCGTCGAGGCCCTGTGCGACCCCCCCGAGGACGTCGAGACGGCGAAGCAGTCCCGGTTCTGCACCTGG
CTGCGCCCGTGGTTCTCCGTCGCCGACCCGGTGCCGATGAAGGAGCAGTACGGATACAAGTACCTGCCGGACATC
GACGGCAACTCCTTCAGCGGCCGGTACCGCGCATTCCTGCTGTCGACGAGCCTGCCGCTCAAGGCCACCATCTAC
GCCGAGTGGCACGACGACCGCCTCTTCCCCTGGGTGCACTTCGTGCCCATGGACAACTCGTTCATGGACGTGTAT
GCGCTCATGGACTACTTCCTCCGCGGCCACGACGCCGAGGCCAGGAAGATTGCGGCCGACGGCAAGAGCTGGGCC
GAGGCCGTCCTGCGGCGCGAGGACATGAAGCTCTACGTCTGGCGGCTGCTGCTGGAGTACGCGAGGGTTGTGGAC
GACGACCGTGACCGACTGGCCTTTGTCGAGGACGCGGGCGAGCACAGCTAG
Transcript >Hirsu2|8705
ATGCCTCTCCTCACCAGGCGGAGTATATTCAAAAGGGTTTCCTTCCTGTCGGCCCTCGTCCTGCTCTTTCTTTTG
CTTCGAGCCCTGGCCCCCGACTTGGGCTTGCGCCTGCGCCGTCCGACGGAGGGCAGGACGCGGAACGGCTCGGCG
GCGGGCCGCCACCCGATCGACGGCCTGACCGGCGACGCTCGGCTCGACTTCGAGGCCGTGCTGGGCAAGCGCTCG
GCCACGCTGGAGCAGGCGGTCGCGCGCTACCTGGAGCGTCGCGGCCGCCGGCCGCCGCCCGGGTTCGGCGACTGG
TACGCGGCGGCGGCGGGCAGCCGGGCCGTCGTCGTCGAGGACTTCTTCGACCGCATCTACCACGACGTGGCGCCG
CTGTGGGCTCTCGACCCGCGGCAGCTGCGCGCCCGGGCCCGCGGCCAGGCCAGCGTCATCCGCGTCCGGCGCGGC
AGGGTCGAGCGCGTCGCCCCGGCCGGCGACCTGTCGTCGCATCGGCTCGAGCAGTGGGCGAGGCTGGTGGGGGAG
ATGGCGCCGCACGTGCCCGACCTCGACATGGCCGTCAACACCATGGACGAGTCGCGCGTGCTCGTCCCGTGGGAG
GACATGGGGCGGTACGTGGCCGAGGAGCGGCGGCGGCGGCGGATCGTCGGCGCCGCCGAGGCCGTCCGCAGCCAC
GGCCGCGACTTGGGCGACGAGGAGAACTCGACGCGGACCGAGGCGACGCGTTGGATCACGGACGAGCCGGGCAAG
TACTGGGATCACCTGGCCAGGGCGTGCCCGCCGGAGAGCCCGGCGCGCACGGCGTCGTCGCTGACGTCGTTGGGC
GGGGCCGTCGAGTACCCCGAGCGGCCGGTGCCGGCGTACACGCACCGCGGCTTCGTCCGGAACTTCACGGCGTCG
CAGGACCCGTGCTGGCAGCCGCACCTGCGCGGCATGCACGGCACCTTCGTCGAGAGCGTCAGCATGTCGACGACG
CACGAGCTCGTCCCCCTGTTCGGCGAGTCCAAGCTGCCGCGCAACAACGAGCTCCTCATCCCGGCGGCCGTCTAC
CTCGACCAAGGCCGGGCCGAATACAGCGGCGGCTCCTCGCACGGCGGCCGCTGGGCGCGCAAGAAGGACGCCATG
GTCTGGCGGGGCGCCGCGTCGGGCGGGCGCCACAAGAGGGACAACTGGCGGCGCATGCACCGGAGCCGCTTCGTG
CGGATGCTCAACGGCACGGCCGTCGCGTCGGTGGAGGACGGCGACGAGGACCCGGCCGCCGCCACCTTCCGCCTC
CCCTCCGCCGGACTGTACCCCGTCGCGGCCCGAGACCGGGGCCGGCTCGGCCCGTGGGTGTCGACCTGGGCCGAC
GTCGGCTTCGTCGAGGCCCTGTGCGACCCCCCCGAGGACGTCGAGACGGCGAAGCAGTCCCGGTTCTGCACCTGG
CTGCGCCCGTGGTTCTCCGTCGCCGACCCGGTGCCGATGAAGGAGCAGTACGGATACAAGTACCTGCCGGACATC
GACGGCAACTCCTTCAGCGGCCGGTACCGCGCATTCCTGCTGTCGACGAGCCTGCCGCTCAAGGCCACCATCTAC
GCCGAGTGGCACGACGACCGCCTCTTCCCCTGGGTGCACTTCGTGCCCATGGACAACTCGTTCATGGACGTGTAT
GCGCTCATGGACTACTTCCTCCGCGGCCACGACGCCGAGGCCAGGAAGATTGCGGCCGACGGCAAGAGCTGGGCC
GAGGCCGTCCTGCGGCGCGAGGACATGAAGCTCTACGTCTGGCGGCTGCTGCTGGAGTACGCGAGGGTTGTGGAC
GACGACCGTGACCGACTGGCCTTTGTCGAGGACGCGGGCGAGCACAGCTAG
Gene >Hirsu2|8705
ATGCCTCTCCTCACCAGGCGGAGTATATTCAAAAGGGTTTCCTTCCTGTCGGCCCTCGTCCTGCTCTTTCTTTTG
CTTCGAGCCCTGGCCCCCGACTTGGGCTTGCGCCTGCGCCGTCCGACGGAGGGCAGGACGCGGAACGGCTCGGCG
GCGGGCCGCCACCCGATCGACGGCCTGACCGGCGACGCTCGGCTCGACTTCGAGGCCGTGCTGGGCAAGCGCTCG
GCCACGCTGGAGCAGGCGGTCGCGCGCTACCTGGAGCGTCGCGGCCGCCGGCCGCCGCCCGGGTTCGGCGACTGG
TACGCGGCGGCGGCGGGCAGCCGGGCCGTCGTCGTCGAGGACTTCTTCGACCGCATCTACCACGACGTGGCGCCG
CTGTGGGCTCTCGACCCGCGGCAGCTGCGCGCCCGGGCCCGCGGCCAGGCCAGCGTCATCCGCGTCCGGCGCGGC
AGGGTCGAGCGCGTCGCCCCGGCCGGCGACCTGTCGTCGCATCGGCTCGAGCAGTGGGCGAGGCTGGTGGGGGAG
ATGGCGCCGCACGTGCCCGACCTCGACATGGCCGTCAACACCATGGACGAGTCGCGCGTGCTCGTCCCGTGGGAG
GACATGGGGCGGTACGTGGCCGAGGAGCGGCGGCGGCGGCGGATCGTCGGCGCCGCCGAGGCCGTCCGCAGCCAC
GGCCGCGACTTGGGCGACGAGGAGAACTCGACGCGGACCGAGGCGACGCGTTGGATCACGGACGAGCCGGGCAAG
TACTGGGATCACCTGGCCAGGGCGTGCCCGCCGGAGAGCCCGGCGCGCACGGCGTCGTCGCTGACGTCGTTGGGC
GGGGCCGTCGAGTACCCCGAGCGGCCGGTGCCGGCGTACACGCACCGCGGCTTCGTCCGGAACTTCACGGCGTCG
CAGGACCCGTGCTGGCAGCCGCACCTGCGCGGCATGCACGGCACCTTCGTCGAGAGCGTCAGCATGTCGACGACG
CACGAGCTCGTCCCCCTGTTCGGCGAGTCCAAGCTGCCGCGCAACAACGAGCTCCTCATCCCGGCGGCCGTCTAC
CTCGACCAAGGCCGGGCCGAATACAGCGGCGGCTCCTCGCACGGCGGCCGCTGGGCGCGCAAGAAGGACGCCATG
GTCTGGCGGGGCGCCGCGTCGGGCGGGCGCCACAAGAGGGACAACTGGCGGCGCATGCACCGGAGCCGCTTCGTG
CGGATGCTCAACGGCACGGCCGTCGCGTCGGTGGAGGACGGCGACGAGGACCCGGCCGCCGCCACCTTCCGCCTC
CCCTCCGCCGGACTGTACCCCGTCGCGGCCCGAGACCGGGGCCGGCTCGGCCCGTGGGTGTCGACCTGGGCCGAC
GTCGGCTTCGTCGAGGCCCTGTGCGACCCCCCCGAGGACGTCGAGACGGCGAAGCAGTCCCGGTTCTGCACCTGG
CTGCGCCCGTGGTTCTCCGTCGCCGACCCGGTGCCGATGAAGGAGCAGTACGGATACAAGTACCTGCCGGACATC
GACGGCAACTCCTTCAGCGGCCGGTACCGCGCATTCCTGCTGTCGACGAGCCTGCCGCTCAAGGCCACCATCTAC
GCCGAGTGGCACGACGACCGCCTCTTCCCCTGGGTGCACTTCGTGCCCATGGACAACTCGTTCATGGACGTGTAT
GCGCTCATGGACTACTTCCTCCGCGGCCACGACGCCGAGGCCAGGAAGATTGCGGCCGACGGCAAGAGCTGGGCC
GAGGCCGTCCTGCGGCGCGAGGACATGAAGCTCTACGTCTGGCGGCTGCTGCTGGAGTACGCGAGGGTTGTGGAC
GACGACCGTGACCGACTGGCCTTTGTCGAGGACGCGGGCGAGCACAGCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail