Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8700
Gene name
LocationContig_585:2345..4526
Strand-
Gene length (bp)2181
Transcript length (bp)1833
Coding sequence length (bp)1833
Protein length (aa) 611

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07732 Cu-oxidase_3 Multicopper oxidase 6.0E-30 36 151
PF00394 Cu-oxidase Multicopper oxidase 5.9E-23 163 321
PF07731 Cu-oxidase_2 Multicopper oxidase 3.3E-16 442 568

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q40588|ASO_TOBAC L-ascorbate oxidase OS=Nicotiana tabacum GN=AAO PE=2 SV=1 53 587 1.0E-57
sp|P37064|ASO_CUCPM L-ascorbate oxidase OS=Cucurbita pepo var. melopepo PE=1 SV=1 44 587 1.0E-57
sp|P24792|ASO_CUCMA L-ascorbate oxidase OS=Cucurbita maxima GN=AAO PE=1 SV=2 44 587 2.0E-57
sp|P14133|ASO_CUCSA L-ascorbate oxidase OS=Cucumis sativus PE=1 SV=1 44 587 2.0E-57
sp|Q6Z8L2|LAC9_ORYSJ Putative laccase-9 OS=Oryza sativa subsp. japonica GN=LAC9 PE=3 SV=1 1 582 2.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q40588|ASO_TOBAC L-ascorbate oxidase OS=Nicotiana tabacum GN=AAO PE=2 SV=1 53 587 1.0E-57
sp|P37064|ASO_CUCPM L-ascorbate oxidase OS=Cucurbita pepo var. melopepo PE=1 SV=1 44 587 1.0E-57
sp|P24792|ASO_CUCMA L-ascorbate oxidase OS=Cucurbita maxima GN=AAO PE=1 SV=2 44 587 2.0E-57
sp|P14133|ASO_CUCSA L-ascorbate oxidase OS=Cucumis sativus PE=1 SV=1 44 587 2.0E-57
sp|Q6Z8L2|LAC9_ORYSJ Putative laccase-9 OS=Oryza sativa subsp. japonica GN=LAC9 PE=3 SV=1 1 582 2.0E-38
sp|Q5ZCW1|LAC1_ORYSJ Putative laccase-1 OS=Oryza sativa subsp. japonica GN=LAC1 PE=3 SV=1 32 582 7.0E-35
sp|Q9LMS3|LAC1_ARATH Laccase-1 OS=Arabidopsis thaliana GN=LAC1 PE=2 SV=1 32 584 2.0E-34
sp|Q941X2|LAC3_ORYSJ Laccase-3 OS=Oryza sativa subsp. japonica GN=LAC3 PE=2 SV=1 12 571 2.0E-32
sp|Q0DHL5|LAC11_ORYSJ Putative laccase-11 OS=Oryza sativa subsp. japonica GN=LAC11 PE=5 SV=2 39 583 2.0E-32
sp|Q9FY79|LAC14_ARATH Laccase-14 OS=Arabidopsis thaliana GN=LAC14 PE=2 SV=1 11 583 3.0E-32
sp|A2XCN6|LAC18_ORYSI Putative laccase-18 OS=Oryza sativa subsp. indica GN=LAC18 PE=3 SV=1 2 571 6.0E-32
sp|Q339K6|LAC15_ORYSJ Laccase-15 OS=Oryza sativa subsp. japonica GN=LAC15 PE=2 SV=1 36 583 6.0E-32
sp|Q84J37|LAC15_ARATH Laccase-15 OS=Arabidopsis thaliana GN=TT10 PE=1 SV=1 20 568 2.0E-31
sp|Q2R0L2|LAC19_ORYSJ Laccase-19 OS=Oryza sativa subsp. japonica GN=LAC19 PE=2 SV=1 36 571 3.0E-30
sp|Q53LU4|LAC18_ORYSJ Laccase-18 OS=Oryza sativa subsp. japonica GN=LAC18 PE=2 SV=1 2 571 3.0E-30
sp|Q9ZPY2|LAC6_ARATH Laccase-6 OS=Arabidopsis thaliana GN=LAC6 PE=2 SV=1 32 583 3.0E-30
sp|A2Y9C5|LAC19_ORYSI Putative laccase-19 OS=Oryza sativa subsp. indica GN=LAC19 PE=3 SV=1 36 571 4.0E-30
sp|Q10ND7|LAC10_ORYSJ Laccase-10 OS=Oryza sativa subsp. japonica GN=LAC10 PE=2 SV=1 32 573 7.0E-30
sp|Q2QZ80|LAC21_ORYSJ Laccase-21 OS=Oryza sativa subsp. japonica GN=LAC21 PE=2 SV=1 4 582 8.0E-30
sp|Q2R0L0|LAC20_ORYSJ Laccase-20 OS=Oryza sativa subsp. japonica GN=LAC20 PE=2 SV=1 36 571 1.0E-29
sp|Q99056|LAC5_TRAVI Laccase-5 OS=Trametes villosa GN=LCC5 PE=3 SV=2 30 567 2.0E-29
sp|A2Y9C2|LAC20_ORYSI Laccase-20 OS=Oryza sativa subsp. indica GN=LAC20 PE=3 SV=1 36 571 7.0E-29
sp|Q5N9X2|LAC4_ORYSJ Laccase-4 OS=Oryza sativa subsp. japonica GN=LAC4 PE=2 SV=1 23 571 7.0E-28
sp|Q1PDH6|LAC16_ARATH Laccase-16 OS=Arabidopsis thaliana GN=LAC16 PE=2 SV=2 45 568 1.0E-27
sp|Q12717|LAC5_TRAVE Laccase-5 OS=Trametes versicolor GN=LCC5 PE=2 SV=1 30 567 3.0E-27
sp|Q5N7B4|LAC7_ORYSJ Laccase-7 OS=Oryza sativa subsp. japonica GN=LAC7 PE=2 SV=1 31 567 6.0E-27
sp|Q5N7A3|LAC6_ORYSJ Laccase-6 OS=Oryza sativa subsp. japonica GN=LAC6 PE=2 SV=1 8 567 1.0E-26
sp|Q6CII3|FET3_KLULA Iron transport multicopper oxidase FET3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FET3 PE=3 SV=1 47 563 1.0E-26
sp|Q0DHL2|LAC12_ORYSJ Laccase-12/13 OS=Oryza sativa subsp. japonica GN=LAC12 PE=2 SV=1 11 571 2.0E-26
sp|Q9LYQ2|LAC13_ARATH Laccase-13 OS=Arabidopsis thaliana GN=LAC13 PE=2 SV=1 9 568 3.0E-26
sp|Q12719|LAC4_TRAVE Laccase-4 OS=Trametes versicolor GN=LCC4 PE=3 SV=1 30 567 7.0E-26
sp|Q8RYM9|LAC2_ORYSJ Laccase-2 OS=Oryza sativa subsp. japonica GN=LAC2 PE=2 SV=1 32 571 1.0E-25
sp|P38993|FET3_YEAST Iron transport multicopper oxidase FET3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FET3 PE=1 SV=2 1 558 1.0E-25
sp|Q69L99|LAC14_ORYSJ Laccase-14 OS=Oryza sativa subsp. japonica GN=LAC14 PE=3 SV=1 46 573 2.0E-25
sp|Q99055|LAC4_TRAVI Laccase-4 OS=Trametes villosa GN=LCC4 PE=3 SV=1 30 567 2.0E-25
sp|Q0IQU1|LAC22_ORYSJ Laccase-22 OS=Oryza sativa subsp. japonica GN=LAC22 PE=2 SV=2 9 568 2.0E-25
sp|Q9FLB5|LAC12_ARATH Laccase-12 OS=Arabidopsis thaliana GN=LAC12 PE=2 SV=1 32 584 6.0E-25
sp|Q02081|LAC4_THACU Laccase-4 OS=Thanatephorus cucumeris GN=LCC4 PE=1 SV=1 31 302 9.0E-25
sp|Q99044|LAC1_TRAVI Laccase-1 OS=Trametes villosa GN=LCC1 PE=3 SV=1 12 321 2.0E-24
sp|Q99046|LAC2_TRAVI Laccase-2 OS=Trametes villosa GN=LCC2 PE=3 SV=1 30 567 3.0E-24
sp|Q9LFD1|LAC9_ARATH Laccase-9 OS=Arabidopsis thaliana GN=LAC9 PE=2 SV=1 9 583 3.0E-24
sp|Q12718|LAC2_TRAVE Laccase-2 OS=Trametes versicolor GN=LCC2 PE=1 SV=1 30 567 4.0E-24
sp|Q96WT3|FET3_CANGA Iron transport multicopper oxidase FET3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FET3 PE=3 SV=1 45 568 5.0E-24
sp|P56193|LAC1_THACU Laccase-1 OS=Thanatephorus cucumeris GN=LCC1 PE=1 SV=1 32 320 5.0E-24
sp|Q8VZA1|LAC11_ARATH Laccase-11 OS=Arabidopsis thaliana GN=LAC11 PE=2 SV=1 32 575 5.0E-24
sp|Q02075|LAC2_THACU Laccase-2 OS=Thanatephorus cucumeris GN=LCC2 PE=2 SV=1 13 285 7.0E-24
sp|Q0JHP8|LAC8_ORYSJ Laccase-8 OS=Oryza sativa subsp. japonica GN=LAC8 PE=3 SV=2 1 567 2.0E-23
sp|Q9LFD2|LAC8_ARATH Laccase-8 OS=Arabidopsis thaliana GN=LAC8 PE=2 SV=1 9 583 5.0E-23
sp|P78591|FET3_CANAX Iron transport multicopper oxidase FET3 OS=Candida albicans GN=FET3 PE=3 SV=1 58 568 1.0E-22
sp|Q02079|LAC3_THACU Laccase-3 OS=Thanatephorus cucumeris GN=LCC3 PE=2 SV=1 32 301 1.0E-22
sp|Q02497|LAC1_TRAHI Laccase OS=Trametes hirsuta PE=1 SV=1 30 302 2.0E-22
sp|Q12729|LAC1_PLEOS Laccase-1 OS=Pleurotus ostreatus GN=POX1 PE=2 SV=1 30 567 3.0E-22
sp|Q2QUN2|LAC24_ORYSJ Laccase-24 OS=Oryza sativa subsp. japonica GN=LAC24 PE=2 SV=1 32 277 3.0E-22
sp|O59896|LAC1_PYCCI Laccase OS=Pycnoporus cinnabarinus GN=LCC3-1 PE=1 SV=1 12 566 3.0E-22
sp|Q01679|LAC1_PHLRA Laccase OS=Phlebia radiata GN=LAC PE=1 SV=2 6 567 5.0E-22
sp|Q99049|LAC3_TRAVI Laccase-3 OS=Trametes villosa GN=LCC3 PE=3 SV=1 10 377 8.0E-22
sp|Q9SIY8|LAC5_ARATH Laccase-5 OS=Arabidopsis thaliana GN=LAC5 PE=2 SV=1 11 584 1.0E-21
sp|D0VWU3|LAC1_TRAMX Laccase OS=Trametes maxima PE=1 SV=1 36 302 1.0E-21
sp|Q12570|LAC1_BOTFU Laccase-1 OS=Botryotinia fuckeliana GN=lcc1 PE=2 SV=3 29 563 1.0E-20
sp|Q6ID18|LAC10_ARATH Laccase-10 OS=Arabidopsis thaliana GN=LAC10 PE=2 SV=1 32 568 3.0E-20
sp|Q9FJD5|LAC17_ARATH Laccase-17 OS=Arabidopsis thaliana GN=LAC17 PE=2 SV=1 32 287 6.0E-20
sp|Q0IP28|LAC25_ORYSJ Laccase-25 OS=Oryza sativa subsp. japonica GN=LAC25 PE=3 SV=1 32 277 1.0E-19
sp|Q12541|LAC1_AGABI Laccase-1 OS=Agaricus bisporus GN=lcc1 PE=1 SV=1 47 302 2.0E-18
sp|Q56YT0|LAC3_ARATH Laccase-3 OS=Arabidopsis thaliana GN=LAC3 PE=2 SV=2 4 320 6.0E-18
sp|Q5N9W4|LAC5_ORYSJ Putative laccase-5 OS=Oryza sativa subsp. japonica GN=LAC5 PE=3 SV=1 32 285 7.0E-18
sp|O81081|LAC2_ARATH Laccase-2 OS=Arabidopsis thaliana GN=LAC2 PE=2 SV=1 32 286 8.0E-18
sp|Q7XE50|LAC16_ORYSJ Putative laccase-16 OS=Oryza sativa subsp. japonica GN=LAC16 PE=5 SV=1 83 582 9.0E-18
sp|Q9SR40|LAC7_ARATH Laccase-7 OS=Arabidopsis thaliana GN=LAC7 PE=2 SV=1 11 277 2.0E-17
sp|P12374|COPA_PSEUB Copper resistance protein A OS=Pseudomonas syringae pv. tomato GN=copA PE=1 SV=1 32 292 2.0E-17
sp|Q9SU40|SKU5_ARATH Monocopper oxidase-like protein SKU5 OS=Arabidopsis thaliana GN=SKU5 PE=1 SV=1 32 323 1.0E-16
sp|P43561|FET5_YEAST Iron transport multicopper oxidase FET5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FET5 PE=1 SV=1 45 576 1.0E-16
sp|Q12542|LAC2_AGABI Laccase-2 OS=Agaricus bisporus GN=lcc2 PE=1 SV=1 47 302 4.0E-16
sp|Q12739|LAC2_PLEOS Laccase-2 OS=Pleurotus ostreatus GN=POX2 PE=1 SV=1 55 320 1.0E-15
sp|Q8VXX5|SKS1_ARATH Monocopper oxidase-like protein SKS1 OS=Arabidopsis thaliana GN=SKS1 PE=1 SV=1 11 333 3.0E-15
sp|Q00624|ASOL_BRANA L-ascorbate oxidase homolog OS=Brassica napus GN=Bp10 PE=2 SV=1 51 562 5.0E-15
sp|O80434|LAC4_ARATH Laccase-4 OS=Arabidopsis thaliana GN=IRX12 PE=2 SV=2 25 285 6.0E-15
sp|Q2QYS3|LAC23_ORYSJ Laccase-23 OS=Oryza sativa subsp. japonica GN=LAC23 PE=3 SV=1 32 277 1.0E-14
sp|D4APX3|LAC1_ARTBC Laccase ARB_05828 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05828 PE=1 SV=1 32 302 1.0E-14
sp|Q96UM2|LAC3_BOTFU Laccase-3 (Fragment) OS=Botryotinia fuckeliana GN=lcc3 PE=3 SV=1 58 563 2.0E-14
sp|Q2RBK2|LAC17_ORYSJ Putative laccase-17 OS=Oryza sativa subsp. japonica GN=LAC17 PE=3 SV=1 32 277 5.0E-14
sp|Q47452|PCOA_ECOLX Copper resistance protein A OS=Escherichia coli GN=pcoA PE=3 SV=1 32 316 5.0E-13
sp|P59571|COPA_PSESM Copper resistance protein A homolog OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=copA PE=3 SV=1 32 292 6.0E-13
sp|Q96WM9|LAC2_BOTFU Laccase-2 OS=Botryotinia fuckeliana GN=lcc2 PE=2 SV=1 32 323 9.0E-12
sp|Q09920|FIO1_SCHPO Iron transport multicopper oxidase fio1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fio1 PE=3 SV=1 1 287 1.0E-11
sp|P29162|ASOL_TOBAC L-ascorbate oxidase homolog OS=Nicotiana tabacum PE=2 SV=1 48 562 1.0E-10
sp|Q03966|LAC1_CRYPA Laccase OS=Cryphonectria parasitica GN=LAC-1 PE=3 SV=1 47 286 2.0E-10
sp|P78722|LAC2_PODAS Laccase-2 OS=Podospora anserina GN=LAC2 PE=2 SV=1 32 286 4.0E-10
sp|P17489|LAC1_EMENI Laccase-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=yA PE=2 SV=3 48 134 4.0E-09
sp|P06811|LAC1_NEUCR Laccase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lacc PE=1 SV=3 32 286 1.0E-08
sp|Q5N9W4|LAC5_ORYSJ Putative laccase-5 OS=Oryza sativa subsp. japonica GN=LAC5 PE=3 SV=1 451 573 2.0E-08
sp|O81081|LAC2_ARATH Laccase-2 OS=Arabidopsis thaliana GN=LAC2 PE=2 SV=1 478 573 9.0E-08
sp|Q70KY3|LAC1_MELAO Laccase-1 OS=Melanocarpus albomyces GN=LAC1 PE=1 SV=1 47 286 2.0E-07
sp|Q56YT0|LAC3_ARATH Laccase-3 OS=Arabidopsis thaliana GN=LAC3 PE=2 SV=2 478 568 3.0E-07
sp|Q8CQF6|MCO_STAES Multicopper oxidase mco OS=Staphylococcus epidermidis (strain ATCC 12228) GN=mco PE=3 SV=2 2 278 3.0E-07
sp|Q9FJD5|LAC17_ARATH Laccase-17 OS=Arabidopsis thaliana GN=LAC17 PE=2 SV=1 478 573 4.0E-07
sp|Q0IP28|LAC25_ORYSJ Laccase-25 OS=Oryza sativa subsp. japonica GN=LAC25 PE=3 SV=1 459 583 4.0E-07
sp|Q4LAB0|MCO_STAHJ Multicopper oxidase mco OS=Staphylococcus haemolyticus (strain JCSC1435) GN=mco PE=3 SV=2 54 278 4.0E-07
sp|Q6GIX3|MCO_STAAR Multicopper oxidase mco OS=Staphylococcus aureus (strain MRSA252) GN=mco PE=3 SV=2 54 278 5.0E-07
sp|Q69HT9|MCO_STAAU Multicopper oxidase mco OS=Staphylococcus aureus GN=mco PE=1 SV=2 54 278 5.0E-07
sp|I6WZK7|MMCO_MYCTU Multicopper oxidase MmcO OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmcO PE=1 SV=1 50 285 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0005507 copper ion binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0046872 metal ion binding No
GO:0008152 metabolic process No
GO:0043169 cation binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8700
MLGAALGAVGLLLAGAARAQLRVHDESFKPNYELRVSEADVNINCQKRHSVVVDGQTPGPTLKMKEGQVTWVRVH
NEMTDKNLTMHWHGLAQRTAPFSDGTPLVSQWPIPAGHFFDYEIKPEKGDAGTYFYHSHVGFQLLTAHGALIVED
ADAQNVADEFGEDLTLLLADHYAATDDEIEAGLLADPFRWSGEPQAVLLGGRSGKFGLDGSAPDPSCEPLVITVK
PDQLYRLRVIGATAISLVKLGIEDHPDLRVVEADGGWTKTVRVDHAQVAPGQRFSFSLQSKSYDEIGRSGKTEYW
IRFESRERPESITGYALLKYNMSGCDLERNPLPDRSPVQLPAETNNYLEGVLQPREWHMRVGFPKSAEVTRTVTI
QINQMLTSGQYVDGKPVGGLVWVQNNETWKEDVQAAANQVPYLISAYQSGTADAGSETLPDLERAKANNGFDPVS
RTFPAAVGEVLDIVWQNNAGPGRNFDFHPMHIHGEHAWDMGSGPGLYSPEAAARFDNGFVPARRDTTILHRYRPR
GEQYETDGWRAWRVRVTKDNIGAWMMHCHVAQHAVMGMNTVWVFGDAPALIGKFPEAPHASGYLSFGGDAYGTKD
RSPEVNHYFE*
Coding >Hirsu2|8700
ATGCTGGGAGCCGCCCTCGGCGCCGTCGGCCTGCTCCTGGCCGGGGCGGCGCGAGCCCAGCTCAGGGTCCACGAT
GAATCCTTCAAGCCCAACTACGAGCTGAGGGTGAGCGAGGCCGACGTGAACATCAACTGCCAGAAGCGGCACTCG
GTCGTCGTCGACGGCCAGACACCTGGACCGACCCTGAAGATGAAGGAGGGCCAGGTGACGTGGGTGCGGGTGCAT
AACGAGATGACGGACAAGAACCTCACCATGCACTGGCACGGGCTGGCGCAGCGGACGGCGCCCTTCTCGGACGGG
ACGCCGCTGGTGAGCCAGTGGCCGATCCCGGCCGGGCACTTCTTCGACTACGAGATCAAGCCGGAGAAGGGCGAC
GCCGGGACCTACTTCTACCACTCGCACGTGGGCTTCCAGCTGCTGACGGCGCACGGGGCGCTGATCGTCGAGGAC
GCCGACGCGCAGAACGTGGCGGACGAGTTCGGCGAGGACCTGACGCTGCTGCTGGCGGACCACTACGCCGCCACC
GACGACGAGATCGAGGCCGGCCTGCTGGCGGACCCGTTCCGCTGGTCGGGCGAGCCGCAGGCCGTCCTGCTGGGC
GGGCGCAGCGGCAAGTTCGGGCTGGACGGCAGCGCGCCGGACCCGTCGTGCGAGCCGCTCGTCATCACCGTCAAG
CCGGACCAGCTGTACCGGCTGCGCGTCATCGGCGCGACGGCCATCTCGCTCGTCAAGCTCGGCATCGAGGACCAC
CCGGACCTGCGGGTGGTCGAGGCCGACGGCGGCTGGACCAAGACGGTCCGCGTCGACCACGCCCAGGTGGCGCCG
GGCCAGCGCTTCAGCTTCAGCCTGCAGAGCAAGTCGTACGACGAGATCGGCCGGAGCGGCAAGACCGAGTACTGG
ATCCGGTTCGAGAGCCGCGAGCGGCCGGAAAGCATCACCGGCTACGCCCTGCTCAAGTACAACATGTCCGGCTGC
GACCTCGAGCGCAACCCGCTGCCGGACCGGTCGCCCGTCCAGCTGCCGGCCGAGACCAACAACTACCTCGAGGGC
GTGCTGCAGCCGCGCGAGTGGCACATGCGCGTCGGCTTCCCCAAGAGCGCCGAGGTCACGCGCACCGTCACGATC
CAGATCAACCAGATGCTCACGAGCGGCCAGTACGTCGACGGCAAGCCCGTCGGCGGCCTGGTCTGGGTGCAAAAC
AACGAGACGTGGAAGGAAGACGTGCAGGCAGCGGCCAACCAGGTGCCGTACCTGATCAGCGCCTACCAGTCCGGC
ACGGCCGACGCCGGCTCGGAGACGCTGCCGGACCTGGAGCGGGCCAAGGCCAACAACGGCTTCGACCCGGTCAGC
CGGACGTTCCCGGCCGCCGTCGGCGAGGTGCTGGACATTGTGTGGCAGAACAACGCCGGGCCCGGGCGCAACTTC
GACTTCCACCCGATGCACATCCACGGCGAGCACGCCTGGGACATGGGCTCCGGCCCCGGCCTCTACAGCCCGGAG
GCCGCGGCCCGGTTCGACAACGGCTTCGTGCCGGCCCGGCGCGACACCACGATCCTGCACCGGTACCGCCCCCGC
GGCGAGCAGTACGAGACGGACGGCTGGCGCGCCTGGCGCGTCCGCGTCACCAAGGACAACATCGGCGCCTGGATG
ATGCACTGCCACGTCGCCCAGCACGCCGTCATGGGCATGAACACCGTCTGGGTCTTTGGCGACGCCCCCGCCCTC
ATCGGCAAGTTCCCCGAGGCCCCCCACGCCAGCGGCTACCTCAGCTTCGGCGGCGACGCCTACGGCACCAAGGAC
CGCAGCCCGGAGGTCAACCACTACTTTGAGTAA
Transcript >Hirsu2|8700
ATGCTGGGAGCCGCCCTCGGCGCCGTCGGCCTGCTCCTGGCCGGGGCGGCGCGAGCCCAGCTCAGGGTCCACGAT
GAATCCTTCAAGCCCAACTACGAGCTGAGGGTGAGCGAGGCCGACGTGAACATCAACTGCCAGAAGCGGCACTCG
GTCGTCGTCGACGGCCAGACACCTGGACCGACCCTGAAGATGAAGGAGGGCCAGGTGACGTGGGTGCGGGTGCAT
AACGAGATGACGGACAAGAACCTCACCATGCACTGGCACGGGCTGGCGCAGCGGACGGCGCCCTTCTCGGACGGG
ACGCCGCTGGTGAGCCAGTGGCCGATCCCGGCCGGGCACTTCTTCGACTACGAGATCAAGCCGGAGAAGGGCGAC
GCCGGGACCTACTTCTACCACTCGCACGTGGGCTTCCAGCTGCTGACGGCGCACGGGGCGCTGATCGTCGAGGAC
GCCGACGCGCAGAACGTGGCGGACGAGTTCGGCGAGGACCTGACGCTGCTGCTGGCGGACCACTACGCCGCCACC
GACGACGAGATCGAGGCCGGCCTGCTGGCGGACCCGTTCCGCTGGTCGGGCGAGCCGCAGGCCGTCCTGCTGGGC
GGGCGCAGCGGCAAGTTCGGGCTGGACGGCAGCGCGCCGGACCCGTCGTGCGAGCCGCTCGTCATCACCGTCAAG
CCGGACCAGCTGTACCGGCTGCGCGTCATCGGCGCGACGGCCATCTCGCTCGTCAAGCTCGGCATCGAGGACCAC
CCGGACCTGCGGGTGGTCGAGGCCGACGGCGGCTGGACCAAGACGGTCCGCGTCGACCACGCCCAGGTGGCGCCG
GGCCAGCGCTTCAGCTTCAGCCTGCAGAGCAAGTCGTACGACGAGATCGGCCGGAGCGGCAAGACCGAGTACTGG
ATCCGGTTCGAGAGCCGCGAGCGGCCGGAAAGCATCACCGGCTACGCCCTGCTCAAGTACAACATGTCCGGCTGC
GACCTCGAGCGCAACCCGCTGCCGGACCGGTCGCCCGTCCAGCTGCCGGCCGAGACCAACAACTACCTCGAGGGC
GTGCTGCAGCCGCGCGAGTGGCACATGCGCGTCGGCTTCCCCAAGAGCGCCGAGGTCACGCGCACCGTCACGATC
CAGATCAACCAGATGCTCACGAGCGGCCAGTACGTCGACGGCAAGCCCGTCGGCGGCCTGGTCTGGGTGCAAAAC
AACGAGACGTGGAAGGAAGACGTGCAGGCAGCGGCCAACCAGGTGCCGTACCTGATCAGCGCCTACCAGTCCGGC
ACGGCCGACGCCGGCTCGGAGACGCTGCCGGACCTGGAGCGGGCCAAGGCCAACAACGGCTTCGACCCGGTCAGC
CGGACGTTCCCGGCCGCCGTCGGCGAGGTGCTGGACATTGTGTGGCAGAACAACGCCGGGCCCGGGCGCAACTTC
GACTTCCACCCGATGCACATCCACGGCGAGCACGCCTGGGACATGGGCTCCGGCCCCGGCCTCTACAGCCCGGAG
GCCGCGGCCCGGTTCGACAACGGCTTCGTGCCGGCCCGGCGCGACACCACGATCCTGCACCGGTACCGCCCCCGC
GGCGAGCAGTACGAGACGGACGGCTGGCGCGCCTGGCGCGTCCGCGTCACCAAGGACAACATCGGCGCCTGGATG
ATGCACTGCCACGTCGCCCAGCACGCCGTCATGGGCATGAACACCGTCTGGGTCTTTGGCGACGCCCCCGCCCTC
ATCGGCAAGTTCCCCGAGGCCCCCCACGCCAGCGGCTACCTCAGCTTCGGCGGCGACGCCTACGGCACCAAGGAC
CGCAGCCCGGAGGTCAACCACTACTTTGAGTAA
Gene >Hirsu2|8700
ATGCTGGGAGCCGCCCTCGGCGCCGTCGGCCTGCTCCTGGCCGGGGCGGCGCGAGCCCAGCTCAGGGTCCACGAT
GAATCCTTCAAGCCCAACTACGAGCTGAGGGTGAGCGAGGCCGACGTGAACATCAACTGCCAGAAGCGGCACTCG
GTCGTCGTCGACGGCCAGACACCTGGACCGACCCTGAAGATGAAGGAGGGCCAGGTGACGTGGGTGCGGGTGCAT
AACGAGATGACGGACAAGAACCTCACCATGGTCAGTCTTCTCTTTTGTTTCTCCTTTTTCTTTCTCTTCTGTTCC
CCCTCGATGGTTGGTGAGAAGGTCCGGGGATGGATGAGTGTGTTCCCTTGTCCTTTGCTGACGGCGGGCAACGAC
AAAACACAGCACTGGCACGGGCTGGCGCAGCGGACGGCGCCCTTCTCGGACGGGACGCCGCTGGTGAGCCAGTGG
CCGATCCCGGCCGGGCACTTCTTCGACTACGAGATCAAGCCGGAGAAGGGCGACGCCGGGACCTACTTCTACCAC
TCGCACGTGGGCTTCCAGCTGCTGACGGCGCACGGGGCGCTGATCGTCGAGGACGCCGACGCGCAGAACGTGGCG
GACGAGTTCGGCGAGGACCTGACGCTGCTGCTGGCGGACCACTACGCCGCCACCGACGACGAGATCGAGGCCGGC
CTGCTGGCGGACCCGTTCCGCTGGTCGGGCGAGCCGCAGGCCGTCCTGCTGGGCGGGCGCAGCGGCAAGTTCGGG
CTGGACGGCAGCGCGCCGGACCCGTCGTGCGAGCCGCTCGTCATCACCGTCAAGCCGGACCAGCTGTACCGGCTG
CGCGTCATCGGCGCGACGGCCATCTCGCTCGTCAAGCTCGGCATCGAGGACCACCCGGACCTGCGGGTGGTCGAG
GCCGACGGCGGCTGGACCAAGACGGTCCGCGTCGACCACGCCCAGGTGGCGCCGGGCCAGCGCTTCAGCTTCAGC
CTGCAGAGCAAGTCGTACGACGAGATCGGCCGGAGCGGCAAGACCGAGTACTGGATCCGGTTCGAGAGCCGCGAG
CGGCCGGAAAGCATCACCGGCTACGCCCTGCTCAAGTACAACATGTCCGGCTGCGACCTCGAGCGCAACCCGCTG
CCGGACCGGTCGCCCGTCCAGCTGCCGGCCGAGACCAACAACTACCTCGAGGGCGTGCTGCAGCCGCGCGAGTGG
CACATGCGCGTCGGCTTCCCCAAGAGCGCCGAGGTCACGCGCACCGTCACGATCCAGATCAACCAGATGCTCACG
AGCGGCCAGTACGTCGACGGCAAGCCCGTCGGCGGCCTGGTCTGGGTGTAAGTCGTTTTTGACTCTCTCAGTCAC
GTACATTCCACTCACTTTCACTCCACTCACTTTCACTCCACTCACTTACACTTGACTCACTTACACACAACTCAC
TCACTTACACACAACTCACTTACACACAACTCACTTACACACAACTCACTCACTTACACACAACTCACTTAACAC
ACAACTCACTTAACACACAACTCACTCACACTCACCACCAGGCAAAACAACGAGACGTGGAAGGAAGACGTGCAG
GCAGCGGCCAACCAGGTGCCGTACCTGATCAGCGCCTACCAGTCCGGCACGGCCGACGCCGGCTCGGAGACGCTG
CCGGACCTGGAGCGGGCCAAGGCCAACAACGGCTTCGACCCGGTCAGCCGGACGTTCCCGGCCGCCGTCGGCGAG
GTGCTGGACATTGTGTGGCAGAACAACGCCGGGCCCGGGCGCAACTTCGACTTCCACCCGATGCACATCCACGGC
GAGCACGCCTGGGACATGGGCTCCGGCCCCGGCCTCTACAGCCCGGAGGCCGCGGCCCGGTTCGACAACGGCTTC
GTGCCGGCCCGGCGCGACACCACGATCCTGCACCGGTACCGCCCCCGCGGCGAGCAGTACGAGACGGACGGCTGG
CGCGCCTGGCGCGTCCGCGTCACCAAGGACAACATCGGCGCCTGGATGATGCACTGCCACGTCGCCCAGCACGCC
GTCATGGGCATGAACACCGTCTGGGTCTTTGGCGACGCCCCCGCCCTCATCGGCAAGTTCCCCGAGGCCCCCCAC
GCCAGCGGCTACCTCAGCTTCGGCGGCGACGCCTACGGCACCAAGGACCGCAGCCCGGAGGTCAACCACTACTTT
GAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail