Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8692
Gene name
LocationContig_584:1161..3054
Strand-
Gene length (bp)1893
Transcript length (bp)1725
Coding sequence length (bp)1725
Protein length (aa) 575

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01564 Spermine_synth Spermine/spermidine synthase domain 8.4E-07 333 440

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8D3Q3|SPEE_VIBVU Polyamine aminopropyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=speE PE=3 SV=1 281 441 7.0E-09
sp|Q7MF74|SPEE_VIBVY Polyamine aminopropyltransferase OS=Vibrio vulnificus (strain YJ016) GN=speE PE=3 SV=1 281 441 8.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 43 65 22
2 75 97 22
3 104 123 19
4 133 155 22
5 202 221 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8692
MSAKQSSAPDGFTPERFERELKELASKAKGDTWGRLAAEQLSLYAKAAFLLALLGLYSVVSPLSLSPVYGSIPAS
IWHSKLLMTGCFVGWAGNLAFRHFLPVRASHLAALVALYIPAVQWFLVGHSGRLGPTWGPVVTEALTLVPLAVLT
AAAVADYLERTRLTVLPGFVADAAPGLGSWAWLKAVEHFAGRHLQAHMGQAVVYTRLGLELVLGGLYAVFARSRF
LVYALPPLLHTLLINTHVPSPAATSSLVSSLMSDGWLMLERRESVTGYVSVLQNVQEGFRVMRCDHSLLGGDWVH
TRQAKLSEPIYGVFVMLEAVRLAERVSPVPDKDSHALVVGLGVGTTPSALVTHGINTTVVEIDPVVHEFAARYFD
LRENNPPVLEDAVSYTSDLAATAPESYDYIIHDVFTGGAEPVDLFTLEFLQGLAALLKPDGVIAINYAGDLNLPA
PKIIVRTIGHVFPTCRIFREVAAGAGVGGGPGVDFTNMVIFCTKTSAPLTFRAPADADHLESPSREQFLQLEHEV
QTAEFLSGDDARVLRKNDTSAVVKGHEKSALGHWAIMRINLPDFVWERW*
Coding >Hirsu2|8692
ATGTCGGCCAAGCAGAGCTCCGCGCCCGACGGCTTCACGCCCGAGCGGTTCGAGAGGGAGTTGAAAGAGCTCGCG
TCAAAGGCCAAGGGCGACACCTGGGGCCGGCTGGCGGCCGAGCAGCTGTCGCTCTACGCCAAGGCCGCCTTCCTG
CTGGCCCTCCTTGGCCTCTACTCGGTCGTCTCGCCCCTCAGCCTGTCGCCCGTGTACGGCTCGATTCCGGCCTCG
ATATGGCACTCCAAGCTGCTCATGACCGGCTGCTTCGTCGGCTGGGCCGGCAACCTGGCGTTCCGGCACTTCCTG
CCCGTCCGGGCGAGCCACCTTGCGGCCCTCGTCGCCCTCTACATCCCGGCCGTCCAATGGTTCCTGGTCGGCCAC
AGCGGCCGGCTCGGCCCGACCTGGGGGCCCGTCGTCACCGAGGCCTTGACCCTGGTCCCGCTCGCCGTCCTCACC
GCCGCCGCCGTCGCCGACTACCTCGAGCGGACGCGCCTGACCGTGCTGCCCGGCTTCGTGGCTGACGCCGCCCCC
GGTCTCGGCTCCTGGGCCTGGCTCAAGGCAGTTGAGCATTTTGCCGGTCGGCACCTGCAGGCTCACATGGGCCAG
GCTGTCGTATACACCCGCCTTGGCTTGGAGCTGGTGCTCGGCGGCCTGTACGCCGTCTTTGCTCGCTCGCGCTTC
CTCGTCTACGCCCTGCCGCCGCTCCTCCACACCCTGCTCATCAACACGCACGTCCCTTCCCCCGCCGCCACCTCG
TCCCTGGTCAGCTCTCTCATGTCCGACGGGTGGCTGATGCTGGAGCGCCGCGAGTCCGTGACGGGCTACGTGTCT
GTGCTGCAGAACGTGCAGGAGGGCTTCCGGGTTATGCGCTGCGATCACAGTCTGCTGGGCGGAGACTGGGTTCAT
ACGCGCCAAGCGAAGCTTTCCGAGCCTATATACGGCGTCTTCGTCATGCTCGAGGCCGTGCGGTTAGCCGAGAGG
GTCAGCCCCGTTCCAGACAAAGATTCTCACGCACTGGTAGTCGGACTCGGCGTGGGAACTACACCCTCGGCCCTG
GTCACTCACGGCATCAATACGACTGTCGTCGAGATCGATCCGGTGGTCCATGAGTTTGCCGCAAGGTATTTTGAT
CTTCGGGAGAACAACCCCCCGGTCTTGGAGGACGCCGTCAGCTATACCTCCGACCTGGCGGCCACGGCACCCGAG
AGCTACGACTACATCATCCACGATGTCTTCACCGGAGGCGCGGAGCCAGTGGATCTGTTCACGCTCGAGTTTCTG
CAGGGGCTTGCGGCTCTTCTCAAGCCGGATGGAGTCATTGCCATCAACTACGCCGGCGATCTGAACTTGCCCGCG
CCCAAGATCATCGTCCGCACCATCGGGCACGTCTTCCCGACTTGCCGCATCTTCCGCGAGGTGGCCGCCGGCGCT
GGCGTTGGCGGGGGGCCCGGCGTCGACTTCACGAACATGGTCATCTTCTGCACCAAGACCAGCGCCCCGCTGACC
TTCCGGGCCCCGGCCGACGCCGACCATCTCGAGAGCCCGTCCAGAGAGCAGTTTCTGCAGCTCGAGCACGAGGTG
CAAACAGCAGAGTTCCTGTCCGGGGACGATGCGAGGGTCCTGCGCAAGAACGACACCAGCGCCGTGGTCAAGGGC
CATGAGAAGAGCGCGCTCGGCCACTGGGCTATCATGAGGATAAACCTGCCAGATTTTGTGTGGGAGCGTTGGTAG
Transcript >Hirsu2|8692
ATGTCGGCCAAGCAGAGCTCCGCGCCCGACGGCTTCACGCCCGAGCGGTTCGAGAGGGAGTTGAAAGAGCTCGCG
TCAAAGGCCAAGGGCGACACCTGGGGCCGGCTGGCGGCCGAGCAGCTGTCGCTCTACGCCAAGGCCGCCTTCCTG
CTGGCCCTCCTTGGCCTCTACTCGGTCGTCTCGCCCCTCAGCCTGTCGCCCGTGTACGGCTCGATTCCGGCCTCG
ATATGGCACTCCAAGCTGCTCATGACCGGCTGCTTCGTCGGCTGGGCCGGCAACCTGGCGTTCCGGCACTTCCTG
CCCGTCCGGGCGAGCCACCTTGCGGCCCTCGTCGCCCTCTACATCCCGGCCGTCCAATGGTTCCTGGTCGGCCAC
AGCGGCCGGCTCGGCCCGACCTGGGGGCCCGTCGTCACCGAGGCCTTGACCCTGGTCCCGCTCGCCGTCCTCACC
GCCGCCGCCGTCGCCGACTACCTCGAGCGGACGCGCCTGACCGTGCTGCCCGGCTTCGTGGCTGACGCCGCCCCC
GGTCTCGGCTCCTGGGCCTGGCTCAAGGCAGTTGAGCATTTTGCCGGTCGGCACCTGCAGGCTCACATGGGCCAG
GCTGTCGTATACACCCGCCTTGGCTTGGAGCTGGTGCTCGGCGGCCTGTACGCCGTCTTTGCTCGCTCGCGCTTC
CTCGTCTACGCCCTGCCGCCGCTCCTCCACACCCTGCTCATCAACACGCACGTCCCTTCCCCCGCCGCCACCTCG
TCCCTGGTCAGCTCTCTCATGTCCGACGGGTGGCTGATGCTGGAGCGCCGCGAGTCCGTGACGGGCTACGTGTCT
GTGCTGCAGAACGTGCAGGAGGGCTTCCGGGTTATGCGCTGCGATCACAGTCTGCTGGGCGGAGACTGGGTTCAT
ACGCGCCAAGCGAAGCTTTCCGAGCCTATATACGGCGTCTTCGTCATGCTCGAGGCCGTGCGGTTAGCCGAGAGG
GTCAGCCCCGTTCCAGACAAAGATTCTCACGCACTGGTAGTCGGACTCGGCGTGGGAACTACACCCTCGGCCCTG
GTCACTCACGGCATCAATACGACTGTCGTCGAGATCGATCCGGTGGTCCATGAGTTTGCCGCAAGGTATTTTGAT
CTTCGGGAGAACAACCCCCCGGTCTTGGAGGACGCCGTCAGCTATACCTCCGACCTGGCGGCCACGGCACCCGAG
AGCTACGACTACATCATCCACGATGTCTTCACCGGAGGCGCGGAGCCAGTGGATCTGTTCACGCTCGAGTTTCTG
CAGGGGCTTGCGGCTCTTCTCAAGCCGGATGGAGTCATTGCCATCAACTACGCCGGCGATCTGAACTTGCCCGCG
CCCAAGATCATCGTCCGCACCATCGGGCACGTCTTCCCGACTTGCCGCATCTTCCGCGAGGTGGCCGCCGGCGCT
GGCGTTGGCGGGGGGCCCGGCGTCGACTTCACGAACATGGTCATCTTCTGCACCAAGACCAGCGCCCCGCTGACC
TTCCGGGCCCCGGCCGACGCCGACCATCTCGAGAGCCCGTCCAGAGAGCAGTTTCTGCAGCTCGAGCACGAGGTG
CAAACAGCAGAGTTCCTGTCCGGGGACGATGCGAGGGTCCTGCGCAAGAACGACACCAGCGCCGTGGTCAAGGGC
CATGAGAAGAGCGCGCTCGGCCACTGGGCTATCATGAGGATAAACCTGCCAGATTTTGTGTGGGAGCGTTGGTAG
Gene >Hirsu2|8692
ATGTCGGCCAAGCAGAGCTCCGCGCCCGACGGCTTCACGCCCGAGCGGTTCGAGAGGGAGTTGAAAGAGCTCGCG
TCAAAGGCCAAGGGCGACACCTGGGGCCGGCTGGCGGCCGAGCAGCTGTCGCTCTACGCCAAGGCCGCCTTCCTG
CTGGCCCTCCTTGGCCTCTACTCGGTCGTCTCGCCCCTCAGCCTGTCGCCCGTGTACGGCTCGATTCCGGCCTCG
ATATGGCACTCCAAGCTGCTCATGACCGGCTGCTTCGTCGGCTGGGCCGGCAACCTGGCGTTCCGGCACTTCCTG
CCCGTCCGGGCGAGCCACCTTGCGGCCCTCGTCGCCCTCTACATCCCGGCCGTCCAATGGTTCCTGGTCGGCCAC
AGCGGCCGGCTCGGCCCGACCTGGGGGCCCGTCGTCACCGAGGCCTTGACCCTGGTCCCGCTCGCCGTCCTCACC
GCCGCCGCCGTCGCCGACTACCTCGAGCGGACGCGCCTGACCGTGCTGCCCGGCTTCGTGGCTGACGCCGCCCCC
GGTCTCGGCTCCTGGGCCTGGCTCAAGGCAGTTGAGCATTTTGCCGGTCGGCACCTGCAGGCTCACATGGGCCAG
GCTGTCGTATACACCCGCCTTGGCTTGGAGCTGGTGCTCGGCGGCCTGTACGCCGTCTTTGCTCGCTCGCGCTTC
CTCGTCTACGCCCTGCCGCCGCTCCTCCACACCCTGCTCATCAACACGCACGTCCCTTCCCCCGCCGCCACCTCG
TCCCTGGTCAGCTCTCTCATGTCCGACGGGTGGCTGATGCTGGAGCGCCGCGAGTCCGTGACGGGCTACGTGTCT
GTGCTGCAGAACGTGCAGGAGGGCTTCCGGGTTATGCGCTGCGATCACAGTCTGCTGGGCGGAGACTGGGTTCAT
ACGCGCCAAGCGAAGCTTTCCGAGCCTATATACGGCGTCTTCGTCATGCTCGAGGCCGTGCGGTTAGCCGAGAGG
GTCAGCCCCGTTCCAGACAAAGATTCTCACGCACTGGTAGTGTAAGTCAGCAAACGCAGATCCCAGTCTCAAGTC
GACGAGGTCGTCGCCAGCTGACAAGAGGGACTTTGGATAGCGGACTCGGCGTGGGAACTACACCCTCGGCCCTGG
TCACTCACGGCATCAATACGACTGTCGTCGAGATCGATCCGGTGGTCCATGAGTTTGCCGCAAGGTATTTTGATC
TTCGGGAGAACAACCCCCCGGTCTTGGAGGACGCCGTCAGCTATACCTCCGACCTGGCGGCCACGGCACCCGAGA
GCTACGACTACATCATCCACGATGTCTTCACCGGAGGCGCGGAGCCAGTGGATCTGTTCACGCTCGAGTTTCTGC
AGGGGCTTGCGGCTCTTCTCAAGCCGGATGGAGTCATTGCCATCGTGAGTCCAGGAGTCTATCCATCCTCTGTGC
CTCGTCTGGGTCGTGGCCAATAGATTGTCGTGCTCGTGGGAGCTCTCTAACCCAACTTCCCAGAACTACGCCGGC
GATCTGAACTTGCCCGCGCCCAAGATCATCGTCCGCACCATCGGGCACGTCTTCCCGACTTGCCGCATCTTCCGC
GAGGTGGCCGCCGGCGCTGGCGTTGGCGGGGGGCCCGGCGTCGACTTCACGAACATGGTCATCTTCTGCACCAAG
ACCAGCGCCCCGCTGACCTTCCGGGCCCCGGCCGACGCCGACCATCTCGAGAGCCCGTCCAGAGAGCAGTTTCTG
CAGCTCGAGCACGAGGTGCAAACAGCAGAGTTCCTGTCCGGGGACGATGCGAGGGTCCTGCGCAAGAACGACACC
AGCGCCGTGGTCAAGGGCCATGAGAAGAGCGCGCTCGGCCACTGGGCTATCATGAGGATAAACCTGCCAGATTTT
GTGTGGGAGCGTTGGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail