Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8689
Gene name
LocationContig_583:6494..8093
Strand-
Gene length (bp)1599
Transcript length (bp)1515
Coding sequence length (bp)1515
Protein length (aa) 505

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 5.1E-23 41 457

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P22152|CRNA_EMENI Nitrate transporter OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=crnA PE=2 SV=2 11 498 1.0E-145
sp|P0DKH0|NRT22_ORYSJ High-affinity nitrate transporter 2.2 OS=Oryza sativa subsp. japonica GN=NRT2.2 PE=1 SV=1 20 461 2.0E-52
sp|P0DKG9|NRT21_ORYSJ High-affinity nitrate transporter 2.1 OS=Oryza sativa subsp. japonica GN=NRT2.1 PE=1 SV=1 20 461 2.0E-52
sp|Q9LPV5|NRT25_ARATH High affinity nitrate transporter 2.5 OS=Arabidopsis thaliana GN=NRT2.5 PE=2 SV=1 20 461 6.0E-52
sp|O82811|NRT21_ARATH High-affinity nitrate transporter 2.1 OS=Arabidopsis thaliana GN=NRT2.1 PE=1 SV=1 20 461 6.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P22152|CRNA_EMENI Nitrate transporter OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=crnA PE=2 SV=2 11 498 1.0E-145
sp|P0DKH0|NRT22_ORYSJ High-affinity nitrate transporter 2.2 OS=Oryza sativa subsp. japonica GN=NRT2.2 PE=1 SV=1 20 461 2.0E-52
sp|P0DKG9|NRT21_ORYSJ High-affinity nitrate transporter 2.1 OS=Oryza sativa subsp. japonica GN=NRT2.1 PE=1 SV=1 20 461 2.0E-52
sp|Q9LPV5|NRT25_ARATH High affinity nitrate transporter 2.5 OS=Arabidopsis thaliana GN=NRT2.5 PE=2 SV=1 20 461 6.0E-52
sp|O82811|NRT21_ARATH High-affinity nitrate transporter 2.1 OS=Arabidopsis thaliana GN=NRT2.1 PE=1 SV=1 20 461 6.0E-52
sp|Q9LMZ9|NRT22_ARATH High-affinity nitrate transporter 2.2 OS=Arabidopsis thaliana GN=NRT2.2 PE=2 SV=1 20 461 9.0E-51
sp|Q9FJH8|NRT24_ARATH High affinity nitrate transporter 2.4 OS=Arabidopsis thaliana GN=NRT2.4 PE=2 SV=1 20 461 3.0E-49
sp|Q9LYK2|NRT27_ARATH High affinity nitrate transporter 2.7 OS=Arabidopsis thaliana GN=NRT2.7 PE=2 SV=1 19 491 5.0E-46
sp|Q9FJH7|NRT23_ARATH High affinity nitrate transporter 2.3 OS=Arabidopsis thaliana GN=NRT2.3 PE=1 SV=1 16 461 8.0E-38
sp|Q9LXH0|NRT26_ARATH High affinity nitrate transporter 2.6 OS=Arabidopsis thaliana GN=NRT2.6 PE=1 SV=1 20 461 9.0E-38
sp|Q94JG1|NRT23_ORYSJ High-affinity nitrate transporter 2.3 OS=Oryza sativa subsp. japonica GN=NRT2.3 PE=1 SV=1 20 493 1.0E-33
sp|A2ZU80|NRT24_ORYSJ Probable high-affinity nitrate transporter 2.4 OS=Oryza sativa subsp. japonica GN=NRT2.4 PE=2 SV=2 19 217 9.0E-17
sp|A2ZU80|NRT24_ORYSJ Probable high-affinity nitrate transporter 2.4 OS=Oryza sativa subsp. japonica GN=NRT2.4 PE=2 SV=2 308 461 1.0E-09
sp|P46907|NARK_BACSU Nitrite extrusion protein OS=Bacillus subtilis (strain 168) GN=narK PE=3 SV=2 48 454 3.0E-08
sp|O33854|NART_STACT Probable nitrate transporter NarT OS=Staphylococcus carnosus (strain TM300) GN=narT PE=1 SV=1 34 454 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 32 54 22
2 69 91 22
3 98 120 22
4 130 152 22
5 165 187 22
6 197 219 22
7 377 396 19
8 406 428 22
9 441 463 22
10 473 492 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8689
MGRALSVLWRAPDLNPITGKARSIPVLNPVDPYGRVFTFSWLGFMLSFWAWYAFPPLLTKTIKADLHLSAADVAN
SNIVSLCATLLLRFAVGPVCDRYGARITFASLMLLGCVPIGLAPLVRDAAGLCAARFFIGVLGATFVPCQVWCTA
FFDSNVVGTANALAGGWGNAGGGVTYFIMPAVFDSLVSRQGMSDSTAWRVTLVVPLACLLTCALGMLFLCPDKPL
DDDDDRKGRAQSIETRSSEADADELRGAAAVPGTITGSTTPDEEKGTPAESRRAAKDGTVAKPKWRATLSVVFCP
QSLFHVATYACSFGAELAINSILASYLQANFPTLSQTRAGNLAAVFGFLNFVARPLGGAVADVLYNSFGHSLWLK
KAWIICCGLVAGTLLIVIGRVDPSEQSGGGLGTMMALIVLTAMFLEAGNGANFALIPHVHPAANGVVSGITGGGG
NLGGVLFSIIFRLLGDGKGYGKAFWIIGASHVGLNLAVSCIAPEPARQAGSQGP*
Coding >Hirsu2|8689
ATGGGCCGTGCCCTCTCCGTGCTCTGGCGGGCCCCGGACCTGAATCCCATCACGGGCAAGGCCCGCAGCATACCC
GTCCTCAACCCGGTCGACCCGTACGGCCGCGTCTTCACCTTCTCCTGGCTGGGCTTCATGCTCAGCTTCTGGGCC
TGGTATGCCTTCCCGCCGCTCCTGACAAAGACCATCAAGGCGGACCTGCACCTCAGCGCGGCCGACGTGGCCAAC
TCCAACATCGTCTCGCTGTGCGCCACGCTGCTGCTGCGCTTCGCCGTCGGCCCCGTCTGCGACCGGTACGGCGCC
CGCATCACCTTCGCCTCGCTGATGCTGCTCGGTTGCGTGCCCATCGGCCTCGCGCCGCTCGTCAGGGACGCCGCC
GGCCTGTGCGCCGCCCGCTTCTTCATCGGCGTCCTGGGCGCCACCTTCGTGCCGTGCCAGGTCTGGTGCACCGCC
TTCTTCGACAGCAACGTGGTCGGGACGGCCAACGCGCTGGCCGGCGGCTGGGGCAACGCCGGCGGCGGCGTCACC
TACTTCATCATGCCTGCCGTCTTCGACTCGCTCGTCTCCCGCCAGGGCATGAGCGACTCGACGGCCTGGCGCGTC
ACCTTGGTCGTGCCGCTCGCCTGCCTACTCACATGCGCCCTGGGCATGCTGTTCCTGTGCCCCGACAAGCCTCTC
GACGATGACGACGATCGGAAGGGGCGGGCGCAGAGTATCGAGACCCGCAGCTCCGAGGCCGATGCCGACGAGCTG
CGGGGCGCAGCAGCCGTGCCCGGCACCATCACCGGCAGCACGACGCCGGACGAAGAAAAAGGGACGCCGGCCGAG
AGCCGTCGAGCCGCCAAGGACGGCACCGTGGCCAAGCCGAAGTGGCGGGCCACCTTGTCTGTCGTCTTCTGCCCG
CAGAGTCTGTTCCACGTCGCCACGTACGCCTGCTCCTTCGGCGCCGAGCTGGCCATCAACTCCATCCTTGCCTCA
TACCTGCAGGCCAACTTCCCGACGCTGAGCCAGACGAGGGCCGGCAACCTCGCCGCCGTCTTTGGTTTCCTCAAC
TTTGTCGCTCGGCCCCTGGGCGGGGCGGTCGCTGATGTGCTCTACAACAGCTTCGGTCACAGCCTGTGGTTGAAG
AAGGCCTGGATCATATGCTGCGGCCTCGTGGCGGGTACGCTGCTCATCGTCATTGGCCGGGTGGATCCTTCGGAG
CAGAGCGGCGGGGGGCTCGGCACAATGATGGCGCTCATCGTGCTGACGGCCATGTTTCTCGAGGCCGGGAACGGT
GCCAACTTTGCCCTCATCCCACACGTCCACCCGGCCGCCAACGGCGTCGTGTCCGGCATCACAGGCGGCGGCGGC
AATCTGGGCGGCGTCCTCTTCAGCATCATTTTCCGCCTCCTGGGCGACGGGAAGGGCTATGGCAAGGCCTTTTGG
ATCATCGGCGCCTCCCACGTGGGCTTGAACCTGGCTGTAAGCTGCATCGCTCCTGAACCGGCGAGGCAGGCGGGC
AGTCAGGGACCGTAG
Transcript >Hirsu2|8689
ATGGGCCGTGCCCTCTCCGTGCTCTGGCGGGCCCCGGACCTGAATCCCATCACGGGCAAGGCCCGCAGCATACCC
GTCCTCAACCCGGTCGACCCGTACGGCCGCGTCTTCACCTTCTCCTGGCTGGGCTTCATGCTCAGCTTCTGGGCC
TGGTATGCCTTCCCGCCGCTCCTGACAAAGACCATCAAGGCGGACCTGCACCTCAGCGCGGCCGACGTGGCCAAC
TCCAACATCGTCTCGCTGTGCGCCACGCTGCTGCTGCGCTTCGCCGTCGGCCCCGTCTGCGACCGGTACGGCGCC
CGCATCACCTTCGCCTCGCTGATGCTGCTCGGTTGCGTGCCCATCGGCCTCGCGCCGCTCGTCAGGGACGCCGCC
GGCCTGTGCGCCGCCCGCTTCTTCATCGGCGTCCTGGGCGCCACCTTCGTGCCGTGCCAGGTCTGGTGCACCGCC
TTCTTCGACAGCAACGTGGTCGGGACGGCCAACGCGCTGGCCGGCGGCTGGGGCAACGCCGGCGGCGGCGTCACC
TACTTCATCATGCCTGCCGTCTTCGACTCGCTCGTCTCCCGCCAGGGCATGAGCGACTCGACGGCCTGGCGCGTC
ACCTTGGTCGTGCCGCTCGCCTGCCTACTCACATGCGCCCTGGGCATGCTGTTCCTGTGCCCCGACAAGCCTCTC
GACGATGACGACGATCGGAAGGGGCGGGCGCAGAGTATCGAGACCCGCAGCTCCGAGGCCGATGCCGACGAGCTG
CGGGGCGCAGCAGCCGTGCCCGGCACCATCACCGGCAGCACGACGCCGGACGAAGAAAAAGGGACGCCGGCCGAG
AGCCGTCGAGCCGCCAAGGACGGCACCGTGGCCAAGCCGAAGTGGCGGGCCACCTTGTCTGTCGTCTTCTGCCCG
CAGAGTCTGTTCCACGTCGCCACGTACGCCTGCTCCTTCGGCGCCGAGCTGGCCATCAACTCCATCCTTGCCTCA
TACCTGCAGGCCAACTTCCCGACGCTGAGCCAGACGAGGGCCGGCAACCTCGCCGCCGTCTTTGGTTTCCTCAAC
TTTGTCGCTCGGCCCCTGGGCGGGGCGGTCGCTGATGTGCTCTACAACAGCTTCGGTCACAGCCTGTGGTTGAAG
AAGGCCTGGATCATATGCTGCGGCCTCGTGGCGGGTACGCTGCTCATCGTCATTGGCCGGGTGGATCCTTCGGAG
CAGAGCGGCGGGGGGCTCGGCACAATGATGGCGCTCATCGTGCTGACGGCCATGTTTCTCGAGGCCGGGAACGGT
GCCAACTTTGCCCTCATCCCACACGTCCACCCGGCCGCCAACGGCGTCGTGTCCGGCATCACAGGCGGCGGCGGC
AATCTGGGCGGCGTCCTCTTCAGCATCATTTTCCGCCTCCTGGGCGACGGGAAGGGCTATGGCAAGGCCTTTTGG
ATCATCGGCGCCTCCCACGTGGGCTTGAACCTGGCTGTAAGCTGCATCGCTCCTGAACCGGCGAGGCAGGCGGGC
AGTCAGGGACCGTAG
Gene >Hirsu2|8689
ATGGGCCGTGCCCTCTCCGTGCTCTGGCGGGCCCCGGACCTGAATCCCATCACGGGCAAGGCCCGCAGCATACCC
GTCCTCAACCCGGTCGACCCGTACGGCCGCGTCTTCACCTTCTCCTGGCTGGGCTTCATGCTCAGCTTCTGGGCC
TGGTGAGAGAGGACCAGTCCCCTCTGATTATCTGCCGCGGGCGCGAGCGGGATGGACGGAGAGGACTGACCGTCG
CGTCACGCCAGGTATGCCTTCCCGCCGCTCCTGACAAAGACCATCAAGGCGGACCTGCACCTCAGCGCGGCCGAC
GTGGCCAACTCCAACATCGTCTCGCTGTGCGCCACGCTGCTGCTGCGCTTCGCCGTCGGCCCCGTCTGCGACCGG
TACGGCGCCCGCATCACCTTCGCCTCGCTGATGCTGCTCGGTTGCGTGCCCATCGGCCTCGCGCCGCTCGTCAGG
GACGCCGCCGGCCTGTGCGCCGCCCGCTTCTTCATCGGCGTCCTGGGCGCCACCTTCGTGCCGTGCCAGGTCTGG
TGCACCGCCTTCTTCGACAGCAACGTGGTCGGGACGGCCAACGCGCTGGCCGGCGGCTGGGGCAACGCCGGCGGC
GGCGTCACCTACTTCATCATGCCTGCCGTCTTCGACTCGCTCGTCTCCCGCCAGGGCATGAGCGACTCGACGGCC
TGGCGCGTCACCTTGGTCGTGCCGCTCGCCTGCCTACTCACATGCGCCCTGGGCATGCTGTTCCTGTGCCCCGAC
AAGCCTCTCGACGATGACGACGATCGGAAGGGGCGGGCGCAGAGTATCGAGACCCGCAGCTCCGAGGCCGATGCC
GACGAGCTGCGGGGCGCAGCAGCCGTGCCCGGCACCATCACCGGCAGCACGACGCCGGACGAAGAAAAAGGGACG
CCGGCCGAGAGCCGTCGAGCCGCCAAGGACGGCACCGTGGCCAAGCCGAAGTGGCGGGCCACCTTGTCTGTCGTC
TTCTGCCCGCAGAGTCTGTTCCACGTCGCCACGTACGCCTGCTCCTTCGGCGCCGAGCTGGCCATCAACTCCATC
CTTGCCTCATACCTGCAGGCCAACTTCCCGACGCTGAGCCAGACGAGGGCCGGCAACCTCGCCGCCGTCTTTGGT
TTCCTCAACTTTGTCGCTCGGCCCCTGGGCGGGGCGGTCGCTGATGTGCTCTACAACAGCTTCGGTCACAGCCTG
TGGTTGAAGAAGGCCTGGATCATATGCTGCGGCCTCGTGGCGGGTACGCTGCTCATCGTCATTGGCCGGGTGGAT
CCTTCGGAGCAGAGCGGCGGGGGGCTCGGCACAATGATGGCGCTCATCGTGCTGACGGCCATGTTTCTCGAGGCC
GGGAACGGTGCCAACTTTGCCCTCATCCCACACGTCCACCCGGCCGCCAACGGCGTCGTGTCCGGCATCACAGGC
GGCGGCGGCAATCTGGGCGGCGTCCTCTTCAGCATCATTTTCCGCCTCCTGGGCGACGGGAAGGGCTATGGCAAG
GCCTTTTGGATCATCGGCGCCTCCCACGTGGGCTTGAACCTGGCTGTAAGCTGCATCGCTCCTGAACCGGCGAGG
CAGGCGGGCAGTCAGGGACCGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail