Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8686
Gene name
LocationContig_582:15361..15781
Strand+
Gene length (bp)420
Transcript length (bp)300
Coding sequence length (bp)300
Protein length (aa) 100

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04193 PQ-loop PQ loop repeat 5.7E-18 16 73

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38279|YPQ3_YEAST Probable vacuolar amino acid transporter YPQ3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTC2 PE=1 SV=1 9 78 6.0E-23
sp|Q10482|STM1_SCHPO Seven transmembrane protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=stm1 PE=1 SV=1 15 80 2.0E-11
sp|Q12010|YPQ1_YEAST Probable vacuolar amino acid transporter YPQ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPQ1 PE=1 SV=1 30 78 7.0E-11
sp|Q95XZ6|LAAT1_CAEEL Lysosomal amino acid transporter 1 OS=Caenorhabditis elegans GN=laat-1 PE=1 SV=2 11 73 2.0E-08
sp|Q06328|YPQ2_YEAST Probable vacuolar amino acid transporter YPQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPQ2 PE=1 SV=1 15 72 4.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 12 31 19
2 46 68 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8686
MAPPTAAPLLDAEAVSGIFGSISIACWVVVFSPQIIQQFRQGNADGLSIQFIIIWLLGDVFNIVGAVLQGVLPTM
VRLPFLPARRARGLSARRTKKQNI*
Coding >Hirsu2|8686
ATGGCGCCTCCGACGGCGGCGCCGCTGCTCGACGCCGAGGCCGTCTCCGGCATCTTCGGATCCATCTCCATCGCC
TGCTGGGTCGTCGTCTTCTCGCCGCAGATCATCCAGCAGTTCCGGCAGGGCAACGCCGACGGGCTATCGATCCAG
TTCATCATCATCTGGCTGCTGGGCGACGTATTCAACATCGTCGGCGCCGTCCTGCAGGGCGTGCTGCCCACCATG
GTACGCCTCCCCTTTCTCCCGGCTCGACGGGCGCGCGGGCTGAGCGCGCGGCGCACAAAAAAACAAAACATCTAG
Transcript >Hirsu2|8686
ATGGCGCCTCCGACGGCGGCGCCGCTGCTCGACGCCGAGGCCGTCTCCGGCATCTTCGGATCCATCTCCATCGCC
TGCTGGGTCGTCGTCTTCTCGCCGCAGATCATCCAGCAGTTCCGGCAGGGCAACGCCGACGGGCTATCGATCCAG
TTCATCATCATCTGGCTGCTGGGCGACGTATTCAACATCGTCGGCGCCGTCCTGCAGGGCGTGCTGCCCACCATG
GTACGCCTCCCCTTTCTCCCGGCTCGACGGGCGCGCGGGCTGAGCGCGCGGCGCACAAAAAAACAAAACATCTAG
Gene >Hirsu2|8686
ATGGCGCCTCCGACGGCGGCGCCGCTGCTCGACGCCGAGGCCGTCTCCGGCATCTTCGGGTAAGAGGACCGCGCC
TTTCGGGGGGGGGGGACGCGACGACGTCGGGACCTGACACGTTTGCTAGATCCATCTCCATCGCCTGCTGGGGTC
CGTGCCGCTCTCTGCCTCTCGCCTCCGCTTCCCCGTGCTGACGCGGCCCCAGTCGTCGTCTTCTCGCCGCAGATC
ATCCAGCAGTTCCGGCAGGGCAACGCCGACGGGCTATCGATCCAGTTCATCATCATCTGGCTGCTGGGCGACGTA
TTCAACATCGTCGGCGCCGTCCTGCAGGGCGTGCTGCCCACCATGGTACGCCTCCCCTTTCTCCCGGCTCGACGG
GCGCGCGGGCTGAGCGCGCGGCGCACAAAAAAACAAAACATCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail