Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8685
Gene name
LocationContig_582:13094..14509
Strand-
Gene length (bp)1415
Transcript length (bp)1341
Coding sequence length (bp)1341
Protein length (aa) 447

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00293 NUDIX NUDIX domain 5.7E-19 295 399
PF09297 zf-NADH-PPase NADH pyrophosphatase zinc ribbon domain 2.2E-08 238 263
PF09296 NUDIX-like NADH pyrophosphatase-like rudimentary NUDIX domain 2.7E-06 70 236

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9DCN1|NUD12_MOUSE Peroxisomal NADH pyrophosphatase NUDT12 OS=Mus musculus GN=Nudt12 PE=1 SV=1 38 436 9.0E-58
sp|Q4R7L8|NUD12_MACFA Peroxisomal NADH pyrophosphatase NUDT12 OS=Macaca fascicularis GN=NUDT12 PE=2 SV=1 37 437 2.0E-57
sp|Q29RH3|NUD12_BOVIN Peroxisomal NADH pyrophosphatase NUDT12 OS=Bos taurus GN=NUDT12 PE=2 SV=1 37 432 7.0E-57
sp|Q5RD76|NUD12_PONAB Peroxisomal NADH pyrophosphatase NUDT12 OS=Pongo abelii GN=NUDT12 PE=2 SV=1 37 437 1.0E-56
sp|Q9BQG2|NUD12_HUMAN Peroxisomal NADH pyrophosphatase NUDT12 OS=Homo sapiens GN=NUDT12 PE=1 SV=1 37 437 9.0E-56
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9DCN1|NUD12_MOUSE Peroxisomal NADH pyrophosphatase NUDT12 OS=Mus musculus GN=Nudt12 PE=1 SV=1 38 436 9.0E-58
sp|Q4R7L8|NUD12_MACFA Peroxisomal NADH pyrophosphatase NUDT12 OS=Macaca fascicularis GN=NUDT12 PE=2 SV=1 37 437 2.0E-57
sp|Q29RH3|NUD12_BOVIN Peroxisomal NADH pyrophosphatase NUDT12 OS=Bos taurus GN=NUDT12 PE=2 SV=1 37 432 7.0E-57
sp|Q5RD76|NUD12_PONAB Peroxisomal NADH pyrophosphatase NUDT12 OS=Pongo abelii GN=NUDT12 PE=2 SV=1 37 437 1.0E-56
sp|Q9BQG2|NUD12_HUMAN Peroxisomal NADH pyrophosphatase NUDT12 OS=Homo sapiens GN=NUDT12 PE=1 SV=1 37 437 9.0E-56
sp|Q9Y7J0|NPY1_SCHPO Probable NADH pyrophosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1778.03c PE=3 SV=1 41 434 7.0E-51
sp|P53164|NPY1_YEAST NADH pyrophosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NPY1 PE=1 SV=1 40 439 2.0E-41
sp|Q94A82|NUD19_ARATH Nudix hydrolase 19, chloroplastic OS=Arabidopsis thaliana GN=NUDT19 PE=1 SV=1 178 400 1.0E-38
sp|Q8JZU0|NUD13_MOUSE Nucleoside diphosphate-linked moiety X motif 13 OS=Mus musculus GN=Nudt13 PE=1 SV=2 213 437 2.0E-36
sp|Q86X67|NUD13_HUMAN Nucleoside diphosphate-linked moiety X motif 13 OS=Homo sapiens GN=NUDT13 PE=2 SV=3 66 437 2.0E-33
sp|Q1IBF8|NUDC_PSEE4 NADH pyrophosphatase OS=Pseudomonas entomophila (strain L48) GN=nudC PE=3 SV=1 204 393 4.0E-25
sp|Q882A9|NUDC_PSESM NADH pyrophosphatase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=nudC PE=3 SV=1 220 396 5.0E-24
sp|C1AGW8|NUDC_MYCBT NADH pyrophosphatase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=nudC PE=3 SV=1 212 400 7.0E-24
sp|A1KNJ7|NUDC_MYCBP NADH pyrophosphatase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=nudC PE=3 SV=1 212 400 7.0E-24
sp|Q7TX14|NUDC_MYCBO NADH pyrophosphatase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=nudC PE=3 SV=1 212 400 7.0E-24
sp|Q48IH8|NUDC_PSE14 NADH pyrophosphatase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=nudC PE=3 SV=1 220 396 1.0E-23
sp|Q4ZTN0|NUDC_PSEU2 NADH pyrophosphatase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=nudC PE=3 SV=1 220 396 2.0E-23
sp|Q9RV62|NUDC_DEIRA NADH pyrophosphatase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=nudC PE=3 SV=1 230 396 3.0E-23
sp|P9WIX5|NUDC_MYCTU NADH pyrophosphatase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=nudC PE=3 SV=1 212 400 7.0E-23
sp|P9WIX4|NUDC_MYCTO NADH pyrophosphatase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=nudC PE=3 SV=1 212 400 7.0E-23
sp|A5U7L9|NUDC_MYCTA NADH pyrophosphatase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=nudC PE=3 SV=1 212 400 7.0E-23
sp|Q3KC83|NUDC_PSEPF NADH pyrophosphatase OS=Pseudomonas fluorescens (strain Pf0-1) GN=nudC PE=3 SV=1 214 393 3.0E-22
sp|A4VLQ5|NUDC_PSEU5 NADH pyrophosphatase OS=Pseudomonas stutzeri (strain A1501) GN=nudC PE=3 SV=1 220 396 3.0E-22
sp|Q4KBL2|NUDC_PSEF5 NADH pyrophosphatase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=nudC PE=3 SV=1 220 393 4.0E-22
sp|A6V6Z8|NUDC_PSEA7 NADH pyrophosphatase OS=Pseudomonas aeruginosa (strain PA7) GN=nudC PE=3 SV=1 220 394 1.0E-21
sp|Q7NTZ8|NUDC_CHRVO NADH pyrophosphatase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=nudC PE=3 SV=1 242 396 1.0E-20
sp|Q02KW6|NUDC_PSEAB NADH pyrophosphatase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=nudC PE=3 SV=1 220 394 2.0E-20
sp|O86062|NUDC_PSEAE NADH pyrophosphatase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nudC PE=3 SV=2 220 394 2.0E-20
sp|B7VB54|NUDC_PSEA8 NADH pyrophosphatase OS=Pseudomonas aeruginosa (strain LESB58) GN=nudC PE=3 SV=1 220 394 3.0E-20
sp|Q65W71|NUDC_MANSM NADH pyrophosphatase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=nudC PE=3 SV=1 240 395 3.0E-20
sp|Q88FQ8|NUDC_PSEPK NADH pyrophosphatase OS=Pseudomonas putida (strain KT2440) GN=nudC PE=3 SV=1 220 396 1.0E-19
sp|B0KMR5|NUDC_PSEPG NADH pyrophosphatase OS=Pseudomonas putida (strain GB-1) GN=nudC PE=3 SV=1 220 393 3.0E-19
sp|B1J6H6|NUDC_PSEPW NADH pyrophosphatase OS=Pseudomonas putida (strain W619) GN=nudC PE=3 SV=1 220 396 5.0E-19
sp|P57965|NUDC_PASMU NADH pyrophosphatase OS=Pasteurella multocida (strain Pm70) GN=nudC PE=3 SV=1 242 391 9.0E-19
sp|A5W1F2|NUDC_PSEP1 NADH pyrophosphatase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=nudC PE=3 SV=1 220 396 1.0E-18
sp|B5XYE2|NUDC_KLEP3 NADH pyrophosphatase OS=Klebsiella pneumoniae (strain 342) GN=nudC PE=3 SV=1 240 436 7.0E-18
sp|A6VQT1|NUDC_ACTSZ NADH pyrophosphatase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=nudC PE=3 SV=1 284 395 1.0E-17
sp|A8AKS7|NUDC_CITK8 NADH pyrophosphatase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=nudC PE=3 SV=1 240 436 2.0E-17
sp|A5UGU3|NUDC_HAEIG NADH pyrophosphatase OS=Haemophilus influenzae (strain PittGG) GN=nudC PE=3 SV=1 222 395 3.0E-17
sp|P44710|NUDC_HAEIN NADH pyrophosphatase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=nudC PE=3 SV=1 222 395 3.0E-17
sp|A6TGQ3|NUDC_KLEP7 NADH pyrophosphatase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=nudC PE=3 SV=1 240 436 3.0E-17
sp|A5UA57|NUDC_HAEIE NADH pyrophosphatase OS=Haemophilus influenzae (strain PittEE) GN=nudC PE=3 SV=1 222 395 3.0E-17
sp|Q4QNB3|NUDC_HAEI8 NADH pyrophosphatase OS=Haemophilus influenzae (strain 86-028NP) GN=nudC PE=3 SV=1 222 395 3.0E-17
sp|B4TCT5|NUDC_SALHS NADH pyrophosphatase OS=Salmonella heidelberg (strain SL476) GN=nudC PE=3 SV=1 240 436 4.0E-17
sp|Q8Z328|NUDC_SALTI NADH pyrophosphatase OS=Salmonella typhi GN=nudC PE=3 SV=1 240 436 5.0E-17
sp|Q6LLW5|NUDC_PHOPR NADH pyrophosphatase OS=Photobacterium profundum GN=nudC PE=3 SV=1 221 377 8.0E-17
sp|B4TQK6|NUDC_SALSV NADH pyrophosphatase OS=Salmonella schwarzengrund (strain CVM19633) GN=nudC PE=3 SV=1 240 436 1.0E-16
sp|C5BHE7|NUDC_EDWI9 NADH pyrophosphatase OS=Edwardsiella ictaluri (strain 93-146) GN=nudC PE=3 SV=1 240 396 2.0E-16
sp|B5F1H9|NUDC_SALA4 NADH pyrophosphatase OS=Salmonella agona (strain SL483) GN=nudC PE=3 SV=1 240 436 2.0E-16
sp|B5BJR5|NUDC_SALPK NADH pyrophosphatase OS=Salmonella paratyphi A (strain AKU_12601) GN=nudC PE=3 SV=1 240 436 2.0E-16
sp|A9N0K8|NUDC_SALPB NADH pyrophosphatase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=nudC PE=3 SV=1 240 436 2.0E-16
sp|Q5PKA4|NUDC_SALPA NADH pyrophosphatase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=nudC PE=3 SV=1 240 436 2.0E-16
sp|B4T0Z8|NUDC_SALNS NADH pyrophosphatase OS=Salmonella newport (strain SL254) GN=nudC PE=3 SV=1 240 436 2.0E-16
sp|B5RFI8|NUDC_SALG2 NADH pyrophosphatase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=nudC PE=3 SV=1 240 436 2.0E-16
sp|B5QYF1|NUDC_SALEP NADH pyrophosphatase OS=Salmonella enteritidis PT4 (strain P125109) GN=nudC PE=3 SV=1 240 436 2.0E-16
sp|B5FQL1|NUDC_SALDC NADH pyrophosphatase OS=Salmonella dublin (strain CT_02021853) GN=nudC PE=3 SV=1 240 436 2.0E-16
sp|Q9L9I5|NUDC_SALTY NADH pyrophosphatase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nudC PE=3 SV=1 240 436 2.0E-16
sp|C0Q2S8|NUDC_SALPC NADH pyrophosphatase OS=Salmonella paratyphi C (strain RKS4594) GN=nudC PE=3 SV=1 240 436 4.0E-16
sp|Q57H59|NUDC_SALCH NADH pyrophosphatase OS=Salmonella choleraesuis (strain SC-B67) GN=nudC PE=3 SV=1 240 436 4.0E-16
sp|Q87KQ7|NUDC_VIBPA NADH pyrophosphatase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=nudC PE=3 SV=1 272 396 7.0E-16
sp|B5Z092|NUDC_ECO5E NADH pyrophosphatase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=nudC PE=3 SV=1 240 436 8.0E-16
sp|Q8X6X7|NUDC_ECO57 NADH pyrophosphatase OS=Escherichia coli O157:H7 GN=nudC PE=3 SV=1 240 436 8.0E-16
sp|B7LUK6|NUDC_ESCF3 NADH pyrophosphatase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=nudC PE=3 SV=1 240 436 9.0E-16
sp|Q31U01|NUDC_SHIBS NADH pyrophosphatase OS=Shigella boydii serotype 4 (strain Sb227) GN=nudC PE=3 SV=1 240 436 9.0E-16
sp|B2TWI3|NUDC_SHIB3 NADH pyrophosphatase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=nudC PE=3 SV=1 240 436 9.0E-16
sp|Q3YUY8|NUDC_SHISS NADH pyrophosphatase OS=Shigella sonnei (strain Ss046) GN=nudC PE=3 SV=1 240 436 9.0E-16
sp|B6I5K7|NUDC_ECOSE NADH pyrophosphatase OS=Escherichia coli (strain SE11) GN=nudC PE=3 SV=1 240 436 9.0E-16
sp|P32664|NUDC_ECOLI NADH pyrophosphatase OS=Escherichia coli (strain K12) GN=nudC PE=1 SV=2 240 436 9.0E-16
sp|B1IUQ1|NUDC_ECOLC NADH pyrophosphatase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=nudC PE=3 SV=1 240 436 9.0E-16
sp|A8A796|NUDC_ECOHS NADH pyrophosphatase OS=Escherichia coli O9:H4 (strain HS) GN=nudC PE=3 SV=1 240 436 9.0E-16
sp|B1XBZ9|NUDC_ECODH NADH pyrophosphatase OS=Escherichia coli (strain K12 / DH10B) GN=nudC PE=3 SV=1 240 436 9.0E-16
sp|C5A0T7|NUDC_ECOBW NADH pyrophosphatase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=nudC PE=3 SV=1 240 436 9.0E-16
sp|B7M7Q5|NUDC_ECO8A NADH pyrophosphatase OS=Escherichia coli O8 (strain IAI1) GN=nudC PE=3 SV=1 240 436 9.0E-16
sp|B7LA85|NUDC_ECO55 NADH pyrophosphatase OS=Escherichia coli (strain 55989 / EAEC) GN=nudC PE=3 SV=1 240 436 9.0E-16
sp|A7ZUL1|NUDC_ECO24 NADH pyrophosphatase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=nudC PE=3 SV=1 240 436 9.0E-16
sp|Q0SY04|NUDC_SHIF8 NADH pyrophosphatase OS=Shigella flexneri serotype 5b (strain 8401) GN=nudC PE=3 SV=1 240 436 9.0E-16
sp|B7NFT7|NUDC_ECOLU NADH pyrophosphatase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=nudC PE=3 SV=1 240 436 9.0E-16
sp|Q1R5W2|NUDC_ECOUT NADH pyrophosphatase OS=Escherichia coli (strain UTI89 / UPEC) GN=nudC PE=3 SV=1 240 436 9.0E-16
sp|A1AIG7|NUDC_ECOK1 NADH pyrophosphatase OS=Escherichia coli O1:K1 / APEC GN=nudC PE=3 SV=1 240 436 9.0E-16
sp|B7MIY2|NUDC_ECO45 NADH pyrophosphatase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=nudC PE=3 SV=1 240 436 9.0E-16
sp|C6DHS8|NUDC_PECCP NADH pyrophosphatase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=nudC PE=3 SV=1 242 436 1.0E-15
sp|B1LNU8|NUDC_ECOSM NADH pyrophosphatase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=nudC PE=3 SV=1 240 436 1.0E-15
sp|B7NRS9|NUDC_ECO7I NADH pyrophosphatase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=nudC PE=3 SV=1 240 436 1.0E-15
sp|Q8FB75|NUDC_ECOL6 NADH pyrophosphatase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nudC PE=3 SV=1 240 436 1.0E-15
sp|Q0TA69|NUDC_ECOL5 NADH pyrophosphatase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=nudC PE=3 SV=1 240 436 1.0E-15
sp|B7N2J8|NUDC_ECO81 NADH pyrophosphatase OS=Escherichia coli O81 (strain ED1a) GN=nudC PE=3 SV=1 240 436 1.0E-15
sp|B7UPF1|NUDC_ECO27 NADH pyrophosphatase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=nudC PE=3 SV=1 240 436 1.0E-15
sp|Q83IS3|NUDC_SHIFL NADH pyrophosphatase OS=Shigella flexneri GN=nudC PE=3 SV=1 240 436 2.0E-15
sp|Q6DAL8|NUDC_PECAS NADH pyrophosphatase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=nudC PE=3 SV=1 242 436 2.0E-15
sp|Q32AG9|NUDC_SHIDS NADH pyrophosphatase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=nudC PE=3 SV=1 218 396 4.0E-15
sp|B7VM66|NUDC_VIBTL NADH pyrophosphatase OS=Vibrio tasmaniensis (strain LGP32) GN=nudC PE=3 SV=1 273 413 6.0E-15
sp|Q8DD17|NUDC_VIBVU NADH pyrophosphatase OS=Vibrio vulnificus (strain CMCP6) GN=nudC PE=3 SV=1 283 396 6.0E-15
sp|A4W5B9|NUDC_ENT38 NADH pyrophosphatase OS=Enterobacter sp. (strain 638) GN=nudC PE=3 SV=1 218 436 1.0E-14
sp|Q19427|NPY1_CAEEL NADH pyrophosphatase OS=Caenorhabditis elegans GN=ndx-9 PE=1 SV=3 285 440 1.0E-14
sp|A7MJ81|NUDC_CROS8 NADH pyrophosphatase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=nudC PE=3 SV=1 240 396 3.0E-14
sp|C3LR63|NUDC_VIBCM NADH pyrophosphatase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=nudC PE=3 SV=1 273 396 2.0E-13
sp|Q9KV27|NUDC_VIBCH NADH pyrophosphatase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=nudC PE=3 SV=1 273 396 2.0E-13
sp|A5F3M9|NUDC_VIBC3 NADH pyrophosphatase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=nudC PE=3 SV=1 273 396 2.0E-13
sp|Q7N961|NUDC_PHOLL NADH pyrophosphatase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=nudC PE=3 SV=1 240 436 3.0E-13
sp|B2VG76|NUDC_ERWT9 NADH pyrophosphatase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=nudC PE=3 SV=1 285 394 3.0E-13
sp|A4TS22|NUDC_YERPP NADH pyrophosphatase OS=Yersinia pestis (strain Pestoides F) GN=nudC PE=3 SV=1 242 436 6.0E-13
sp|Q1CN68|NUDC_YERPN NADH pyrophosphatase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=nudC PE=3 SV=1 242 436 6.0E-13
sp|A9R8D3|NUDC_YERPG NADH pyrophosphatase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=nudC PE=3 SV=1 242 436 6.0E-13
sp|Q8ZAQ5|NUDC_YERPE NADH pyrophosphatase OS=Yersinia pestis GN=nudC PE=3 SV=1 242 436 6.0E-13
sp|Q1C1V1|NUDC_YERPA NADH pyrophosphatase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=nudC PE=3 SV=1 242 436 6.0E-13
sp|B1JJK8|NUDC_YERPY NADH pyrophosphatase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=nudC PE=3 SV=1 242 436 7.0E-13
sp|Q66FP3|NUDC_YERPS NADH pyrophosphatase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=nudC PE=3 SV=1 242 436 7.0E-13
sp|B2K122|NUDC_YERPB NADH pyrophosphatase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=nudC PE=3 SV=1 242 436 7.0E-13
sp|A7FNH4|NUDC_YERP3 NADH pyrophosphatase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=nudC PE=3 SV=1 242 436 7.0E-13
sp|A1JIJ0|NUDC_YERE8 NADH pyrophosphatase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=nudC PE=3 SV=1 280 436 1.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0016787 hydrolase activity Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8685
MSSSAASPPPPPAPPQADDSAAAGSASDSMLSRRFGKEVVNYYAGSRLNRYSFLRSDAAFLSRAVASPVSRFILL
HNLSPLVFASSSNSNNNNSAAPSHPPPTPPQLASFTFDDVKPLIGPDPFARTDRQAIDAFDSHAPGGPLIVFLGA
IDEGPGVSADDVAHLDTSAHGVVRAQPFFAVDATPPARAGPEAEAIAAFLERHEARGVSIQTDVRSMTFDFDAAS
MFAQARSMMDWNARNPFCAGCGSPTLSIEAGYKRVCPPADLHGPPRPDCPTRRGISNLCFPRSDPTMIAAVVSAD
GQRILLGRQSRYPPRWYSTLAGFLEPGESVEDAVRREVWEEAGVKVGRVVIHSTQPWPYPSTLMLGAIAQALPGH
ENILLNDNELEAAQWFTLDQVRLALTKTSSMADRAPKGDDDGSLRVPPPQAIANRLMTAVVQGFLTGIPKI*
Coding >Hirsu2|8685
ATGTCCTCCTCCGCCGCCTCGCCCCCGCCGCCGCCGGCTCCTCCGCAGGCCGATGACTCCGCCGCCGCCGGCTCC
GCCTCCGACTCCATGCTCTCCCGGCGCTTCGGCAAGGAAGTCGTCAACTACTACGCCGGCAGCCGCCTCAACCGC
TACTCCTTCCTCCGCTCCGACGCCGCGTTCCTGTCCCGGGCCGTTGCCAGCCCCGTCTCGCGCTTCATCCTCCTC
CACAACCTGAGCCCGCTCGTCTTCGCCAGCAGCAGCAACAGCAACAACAACAACTCCGCCGCGCCCTCTCATCCT
CCTCCTACTCCTCCCCAGCTCGCCTCCTTCACCTTCGACGACGTGAAGCCCCTGATAGGGCCCGACCCCTTTGCC
CGGACCGACAGGCAGGCCATCGATGCCTTCGACTCCCACGCCCCGGGGGGGCCGCTCATTGTCTTCTTGGGCGCA
ATCGACGAGGGTCCGGGCGTCTCCGCCGATGACGTCGCTCATCTCGACACTTCCGCTCACGGCGTCGTTCGCGCC
CAGCCCTTCTTCGCCGTCGATGCCACGCCTCCGGCCCGAGCCGGTCCCGAGGCCGAAGCCATCGCCGCCTTCCTG
GAGCGGCACGAAGCCAGGGGCGTGTCCATCCAGACCGATGTTCGGAGTATGACCTTCGACTTTGATGCCGCCTCC
ATGTTCGCGCAGGCAAGGTCCATGATGGACTGGAACGCCCGCAACCCGTTCTGCGCCGGCTGCGGCTCGCCCACC
CTCTCCATCGAGGCCGGCTACAAGCGCGTCTGCCCCCCGGCCGACCTCCACGGCCCGCCCCGGCCCGACTGCCCC
ACCCGGCGCGGCATCTCCAACCTGTGCTTCCCCCGGTCCGATCCCACCATGATCGCCGCCGTCGTCTCCGCCGAC
GGCCAGCGCATCCTGCTCGGCCGCCAGTCCCGCTACCCGCCCCGCTGGTACAGCACCCTTGCCGGCTTCCTCGAG
CCCGGCGAGTCCGTCGAGGACGCCGTCCGCCGCGAGGTCTGGGAAGAGGCTGGCGTCAAGGTCGGCCGCGTCGTC
ATCCACTCCACCCAGCCCTGGCCTTATCCCTCCACCTTGATGCTCGGCGCCATTGCCCAGGCCCTGCCCGGCCAC
GAGAACATCCTCCTCAACGACAACGAGCTCGAGGCTGCCCAGTGGTTCACGCTCGATCAGGTGCGCCTCGCTTTG
ACCAAGACGTCTTCCATGGCCGACCGGGCCCCCAAGGGAGATGATGACGGAAGCCTGCGCGTGCCCCCGCCTCAG
GCTATCGCCAACCGCCTCATGACGGCCGTCGTCCAGGGCTTCCTGACCGGAATCCCCAAGATATGA
Transcript >Hirsu2|8685
ATGTCCTCCTCCGCCGCCTCGCCCCCGCCGCCGCCGGCTCCTCCGCAGGCCGATGACTCCGCCGCCGCCGGCTCC
GCCTCCGACTCCATGCTCTCCCGGCGCTTCGGCAAGGAAGTCGTCAACTACTACGCCGGCAGCCGCCTCAACCGC
TACTCCTTCCTCCGCTCCGACGCCGCGTTCCTGTCCCGGGCCGTTGCCAGCCCCGTCTCGCGCTTCATCCTCCTC
CACAACCTGAGCCCGCTCGTCTTCGCCAGCAGCAGCAACAGCAACAACAACAACTCCGCCGCGCCCTCTCATCCT
CCTCCTACTCCTCCCCAGCTCGCCTCCTTCACCTTCGACGACGTGAAGCCCCTGATAGGGCCCGACCCCTTTGCC
CGGACCGACAGGCAGGCCATCGATGCCTTCGACTCCCACGCCCCGGGGGGGCCGCTCATTGTCTTCTTGGGCGCA
ATCGACGAGGGTCCGGGCGTCTCCGCCGATGACGTCGCTCATCTCGACACTTCCGCTCACGGCGTCGTTCGCGCC
CAGCCCTTCTTCGCCGTCGATGCCACGCCTCCGGCCCGAGCCGGTCCCGAGGCCGAAGCCATCGCCGCCTTCCTG
GAGCGGCACGAAGCCAGGGGCGTGTCCATCCAGACCGATGTTCGGAGTATGACCTTCGACTTTGATGCCGCCTCC
ATGTTCGCGCAGGCAAGGTCCATGATGGACTGGAACGCCCGCAACCCGTTCTGCGCCGGCTGCGGCTCGCCCACC
CTCTCCATCGAGGCCGGCTACAAGCGCGTCTGCCCCCCGGCCGACCTCCACGGCCCGCCCCGGCCCGACTGCCCC
ACCCGGCGCGGCATCTCCAACCTGTGCTTCCCCCGGTCCGATCCCACCATGATCGCCGCCGTCGTCTCCGCCGAC
GGCCAGCGCATCCTGCTCGGCCGCCAGTCCCGCTACCCGCCCCGCTGGTACAGCACCCTTGCCGGCTTCCTCGAG
CCCGGCGAGTCCGTCGAGGACGCCGTCCGCCGCGAGGTCTGGGAAGAGGCTGGCGTCAAGGTCGGCCGCGTCGTC
ATCCACTCCACCCAGCCCTGGCCTTATCCCTCCACCTTGATGCTCGGCGCCATTGCCCAGGCCCTGCCCGGCCAC
GAGAACATCCTCCTCAACGACAACGAGCTCGAGGCTGCCCAGTGGTTCACGCTCGATCAGGTGCGCCTCGCTTTG
ACCAAGACGTCTTCCATGGCCGACCGGGCCCCCAAGGGAGATGATGACGGAAGCCTGCGCGTGCCCCCGCCTCAG
GCTATCGCCAACCGCCTCATGACGGCCGTCGTCCAGGGCTTCCTGACCGGAATCCCCAAGATATGA
Gene >Hirsu2|8685
ATGTCCTCCTCCGCCGCCTCGCCCCCGCCGCCGCCGGCTCCTCCGCAGGCCGATGACTCCGCCGCCGCCGGCTCC
GCCTCCGACTCCATGCTCTCCCGGCGCTTCGGCAAGGAAGTCGTCAACTACTACGCCGGCAGCCGCCTCAACCGC
TACTCCTTCCTCCGCTCCGACGCCGCGTTCCTGTCCCGGGCCGTTGCCAGCCCCGTCTCGCGCTTCATCCTCCTC
CACAACCTGAGCCCGCTCGTCTTCGCCAGCAGCAGCAACAGCAACAACAACAACTCCGCCGCGCCCTCTCATCCT
CCTCCTACTCCTCCCCAGCTCGCCTCCTTCACCTTCGACGACGTGAAGCCCCTGATAGGGCCCGACCCCTTTGCC
CGGACCGACAGGCAGGCCATCGATGCCTTCGACTCCCACGCCCCGGGGGGGCCGCTCATTGTCTTCTTGGGCGCA
ATCGACGAGGGTCCGGGCGTCTCCGCCGATGACGTCGCTCATCTCGACACTTCCGCTCACGGCGTCGTTCGCGCC
CAGCCCTTCTTCGCCGTCGATGCCACGCCTCCGGCCCGAGCCGGTCCCGAGGCCGAAGCCATCGCCGCCTTCCTG
GAGCGGCACGAAGCCAGGGGCGTGTCCATCCAGACCGATGTTCGGAGTATGACCTTCGACTTTGATGCCGGTACC
GGACCCTTCCCCCCTCCCCTTTGTTCCGACCCTCTCTGCCACGGCTTCCTCTGACGTGTTGCTCGCCAGCCTCCA
TGTTCGCGCAGGCAAGGTCCATGATGGACTGGAACGCCCGCAACCCGTTCTGCGCCGGCTGCGGCTCGCCCACCC
TCTCCATCGAGGCCGGCTACAAGCGCGTCTGCCCCCCGGCCGACCTCCACGGCCCGCCCCGGCCCGACTGCCCCA
CCCGGCGCGGCATCTCCAACCTGTGCTTCCCCCGGTCCGATCCCACCATGATCGCCGCCGTCGTCTCCGCCGACG
GCCAGCGCATCCTGCTCGGCCGCCAGTCCCGCTACCCGCCCCGCTGGTACAGCACCCTTGCCGGCTTCCTCGAGC
CCGGCGAGTCCGTCGAGGACGCCGTCCGCCGCGAGGTCTGGGAAGAGGCTGGCGTCAAGGTCGGCCGCGTCGTCA
TCCACTCCACCCAGCCCTGGCCTTATCCCTCCACCTTGATGCTCGGCGCCATTGCCCAGGCCCTGCCCGGCCACG
AGAACATCCTCCTCAACGACAACGAGCTCGAGGCTGCCCAGTGGTTCACGCTCGATCAGGTGCGCCTCGCTTTGA
CCAAGACGTCTTCCATGGCCGACCGGGCCCCCAAGGGAGATGATGACGGAAGCCTGCGCGTGCCCCCGCCTCAGG
CTATCGCCAACCGCCTCATGACGGCCGTCGTCCAGGGCTTCCTGACCGGAATCCCCAAGATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail