Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8678
Gene name
LocationContig_581:6080..6472
Strand-
Gene length (bp)392
Transcript length (bp)213
Coding sequence length (bp)213
Protein length (aa) 71

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00584 SecE SecE/Sec61-gamma subunits of protein translocation complex 7.9E-12 14 66

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C2D4|SC61G_NEUCR Probable protein transport protein Sec61 subunit gamma OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=9G6.310 PE=3 SV=2 1 70 3.0E-32
sp|Q09827|SC61G_SCHPO Probable protein transport protein Sec61 subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sss1 PE=3 SV=1 1 70 5.0E-24
sp|Q66KU2|SC61G_XENLA Protein transport protein Sec61 subunit gamma OS=Xenopus laevis GN=sec61g PE=3 SV=1 3 69 2.0E-21
sp|P60060|SC61G_MOUSE Protein transport protein Sec61 subunit gamma OS=Mus musculus GN=Sec61g PE=3 SV=1 3 69 4.0E-21
sp|P60059|SC61G_HUMAN Protein transport protein Sec61 subunit gamma OS=Homo sapiens GN=SEC61G PE=1 SV=1 3 69 4.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C2D4|SC61G_NEUCR Probable protein transport protein Sec61 subunit gamma OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=9G6.310 PE=3 SV=2 1 70 3.0E-32
sp|Q09827|SC61G_SCHPO Probable protein transport protein Sec61 subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sss1 PE=3 SV=1 1 70 5.0E-24
sp|Q66KU2|SC61G_XENLA Protein transport protein Sec61 subunit gamma OS=Xenopus laevis GN=sec61g PE=3 SV=1 3 69 2.0E-21
sp|P60060|SC61G_MOUSE Protein transport protein Sec61 subunit gamma OS=Mus musculus GN=Sec61g PE=3 SV=1 3 69 4.0E-21
sp|P60059|SC61G_HUMAN Protein transport protein Sec61 subunit gamma OS=Homo sapiens GN=SEC61G PE=1 SV=1 3 69 4.0E-21
sp|P60058|SC61G_CANLF Protein transport protein Sec61 subunit gamma OS=Canis lupus familiaris GN=SEC61G PE=1 SV=1 3 69 4.0E-21
sp|Q3T104|SC61G_BOVIN Protein transport protein Sec61 subunit gamma OS=Bos taurus GN=SEC61G PE=3 SV=1 3 69 4.0E-21
sp|Q7Z1B8|S61G1_GRYOR Protein transport protein Sec61 subunit gamma OS=Gryllotalpa orientalis GN=SEC61G PE=3 SV=1 3 69 6.0E-21
sp|Q7T207|SC61G_HARAN Protein transport protein Sec61 subunit gamma OS=Harpagifer antarcticus GN=sec61g PE=3 SV=1 3 69 7.0E-21
sp|Q7SZU9|SC61G_GADMO Protein transport protein Sec61 subunit gamma OS=Gadus morhua GN=sec61g PE=3 SV=1 3 69 7.0E-21
sp|P38385|SC61G_ORYSJ Protein transport protein Sec61 subunit gamma OS=Oryza sativa subsp. japonica GN=Os02g0178400 PE=3 SV=1 3 70 1.0E-20
sp|Q19967|SC61G_CAEEL Protein transport protein Sec61 subunit gamma OS=Caenorhabditis elegans GN=emo-1 PE=2 SV=1 3 69 2.0E-20
sp|P0DI74|S61G1_ARATH Protein transport protein Sec61 subunit gamma-1 OS=Arabidopsis thaliana GN=SEC61G1 PE=1 SV=1 3 70 2.0E-20
sp|P0DI75|S61G2_ARATH Protein transport protein Sec61 subunit gamma-2 OS=Arabidopsis thaliana GN=SEC61G2 PE=1 SV=1 3 70 2.0E-20
sp|Q962X7|SC61G_BRABE Protein transport protein Sec61 subunit gamma OS=Branchiostoma belcheri GN=SEC61G PE=3 SV=1 3 69 3.0E-20
sp|Q8I7D9|SC61G_CIOIN Protein transport protein Sec61 subunit gamma OS=Ciona intestinalis GN=SEC61G PE=3 SV=1 3 69 1.0E-19
sp|Q9VWE9|S61G2_DROME Protein transport protein Sec61 gamma-2 subunit OS=Drosophila melanogaster GN=Sec61gamma PE=3 SV=1 3 69 2.0E-19
sp|Q9V668|S61G1_DROME Protein transport protein Sec61 gamma-1 subunit OS=Drosophila melanogaster GN=SEC61G1 PE=3 SV=1 3 69 3.0E-19
sp|P35179|SC61G_YEAST Protein transport protein SSS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSS1 PE=1 SV=2 3 67 3.0E-19
sp|Q9SMP2|S61G3_ARATH Protein transport protein Sec61 subunit gamma-3 OS=Arabidopsis thaliana GN=SEC61G3 PE=1 SV=1 3 70 2.0E-18
sp|Q54JV6|SC61G_DICDI Protein transport protein Sec61 subunit gamma OS=Dictyostelium discoideum GN=sec61g PE=3 SV=1 13 68 6.0E-16
sp|Q8SRW9|SC61G_ENCCU Probable protein transport protein Sec61 subunit gamma OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU05_0885 PE=3 SV=1 14 69 3.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0006886 intracellular protein transport Yes
GO:0006605 protein targeting Yes
GO:0009987 cellular process No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0071702 organic substance transport No
GO:0071705 nitrogen compound transport No
GO:0070727 cellular macromolecule localization No
GO:0051641 cellular localization No
GO:0045184 establishment of protein localization No
GO:0051649 establishment of localization in cell No
GO:0008104 protein localization No
GO:0033036 macromolecule localization No
GO:0046907 intracellular transport No
GO:0110165 cellular anatomical entity No
GO:0006810 transport No
GO:0005575 cellular_component No
GO:0015031 protein transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.5

Transmembrane Domains

Domain # Start End Length
1 40 62 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8678
MADSVEGFIDVPREFLKDGLQFIHKCQKPDQKEFVKISQAIAIGFLTMGTVGYIVKLIHIPINNILVGAA*
Coding >Hirsu2|8678
ATGGCAGATTCGGTCGAGGGCTTCATCGACGTGCCCCGCGAGTTCCTCAAGGACGGGCTGCAGTTCATCCACAAG
TGCCAGAAGCCCGACCAGAAGGAGTTTGTCAAGATCTCGCAGGCCATTGCCATCGGCTTCCTGACCATGGGCACC
GTCGGCTACATCGTCAAGCTGATCCACATCCCGATCAACAACATCCTCGTCGGCGCCGCATGA
Transcript >Hirsu2|8678
ATGGCAGATTCGGTCGAGGGCTTCATCGACGTGCCCCGCGAGTTCCTCAAGGACGGGCTGCAGTTCATCCACAAG
TGCCAGAAGCCCGACCAGAAGGAGTTTGTCAAGATCTCGCAGGCCATTGCCATCGGCTTCCTGACCATGGGCACC
GTCGGCTACATCGTCAAGCTGATCCACATCCCGATCAACAACATCCTCGTCGGCGCCGCATGA
Gene >Hirsu2|8678
ATGGCAGATTCGGTCGAGGGCTTCATCGACGTGCCCCGCGAGTTCCTCAAGGACGGGCTGCAGTTCATCCACAAG
TGCCAGAAGCGTGAGCCCGCCCCCCCCCCCGGCCGAGGAGGGGGGAGGAAGAGGAGATGGCCTCACCTCGTCCAG
CCGTTGTTTCCTGCTCGCTGACGACGCACACCCGTGACAGCCGACCAGAAGGAGTTTGTCAAGATCTCGCAGGCC
ATTGCCATCGGCTTCCTGACCATGGGCACCGTCGGCTACATCGTCAAGCTGAGTACGCCTGTGCCCCCCCTGCCA
CGGTCCGTCGCCCGACGAGATGCTGACGCCAGGTCCTTGACCTCTGCGCAGTCCACATCCCGATCAACAACATCC
TCGTCGGCGCCGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail