Protein ID | Hirsu2|8678 |
Gene name | |
Location | Contig_581:6080..6472 |
Strand | - |
Gene length (bp) | 392 |
Transcript length (bp) | 213 |
Coding sequence length (bp) | 213 |
Protein length (aa) | 71 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00584 | SecE | SecE/Sec61-gamma subunits of protein translocation complex | 7.9E-12 | 14 | 66 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q9C2D4|SC61G_NEUCR | Probable protein transport protein Sec61 subunit gamma OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=9G6.310 PE=3 SV=2 | 1 | 70 | 3.0E-32 |
sp|Q09827|SC61G_SCHPO | Probable protein transport protein Sec61 subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sss1 PE=3 SV=1 | 1 | 70 | 5.0E-24 |
sp|Q66KU2|SC61G_XENLA | Protein transport protein Sec61 subunit gamma OS=Xenopus laevis GN=sec61g PE=3 SV=1 | 3 | 69 | 2.0E-21 |
sp|P60060|SC61G_MOUSE | Protein transport protein Sec61 subunit gamma OS=Mus musculus GN=Sec61g PE=3 SV=1 | 3 | 69 | 4.0E-21 |
sp|P60059|SC61G_HUMAN | Protein transport protein Sec61 subunit gamma OS=Homo sapiens GN=SEC61G PE=1 SV=1 | 3 | 69 | 4.0E-21 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q9C2D4|SC61G_NEUCR | Probable protein transport protein Sec61 subunit gamma OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=9G6.310 PE=3 SV=2 | 1 | 70 | 3.0E-32 |
sp|Q09827|SC61G_SCHPO | Probable protein transport protein Sec61 subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sss1 PE=3 SV=1 | 1 | 70 | 5.0E-24 |
sp|Q66KU2|SC61G_XENLA | Protein transport protein Sec61 subunit gamma OS=Xenopus laevis GN=sec61g PE=3 SV=1 | 3 | 69 | 2.0E-21 |
sp|P60060|SC61G_MOUSE | Protein transport protein Sec61 subunit gamma OS=Mus musculus GN=Sec61g PE=3 SV=1 | 3 | 69 | 4.0E-21 |
sp|P60059|SC61G_HUMAN | Protein transport protein Sec61 subunit gamma OS=Homo sapiens GN=SEC61G PE=1 SV=1 | 3 | 69 | 4.0E-21 |
sp|P60058|SC61G_CANLF | Protein transport protein Sec61 subunit gamma OS=Canis lupus familiaris GN=SEC61G PE=1 SV=1 | 3 | 69 | 4.0E-21 |
sp|Q3T104|SC61G_BOVIN | Protein transport protein Sec61 subunit gamma OS=Bos taurus GN=SEC61G PE=3 SV=1 | 3 | 69 | 4.0E-21 |
sp|Q7Z1B8|S61G1_GRYOR | Protein transport protein Sec61 subunit gamma OS=Gryllotalpa orientalis GN=SEC61G PE=3 SV=1 | 3 | 69 | 6.0E-21 |
sp|Q7T207|SC61G_HARAN | Protein transport protein Sec61 subunit gamma OS=Harpagifer antarcticus GN=sec61g PE=3 SV=1 | 3 | 69 | 7.0E-21 |
sp|Q7SZU9|SC61G_GADMO | Protein transport protein Sec61 subunit gamma OS=Gadus morhua GN=sec61g PE=3 SV=1 | 3 | 69 | 7.0E-21 |
sp|P38385|SC61G_ORYSJ | Protein transport protein Sec61 subunit gamma OS=Oryza sativa subsp. japonica GN=Os02g0178400 PE=3 SV=1 | 3 | 70 | 1.0E-20 |
sp|Q19967|SC61G_CAEEL | Protein transport protein Sec61 subunit gamma OS=Caenorhabditis elegans GN=emo-1 PE=2 SV=1 | 3 | 69 | 2.0E-20 |
sp|P0DI74|S61G1_ARATH | Protein transport protein Sec61 subunit gamma-1 OS=Arabidopsis thaliana GN=SEC61G1 PE=1 SV=1 | 3 | 70 | 2.0E-20 |
sp|P0DI75|S61G2_ARATH | Protein transport protein Sec61 subunit gamma-2 OS=Arabidopsis thaliana GN=SEC61G2 PE=1 SV=1 | 3 | 70 | 2.0E-20 |
sp|Q962X7|SC61G_BRABE | Protein transport protein Sec61 subunit gamma OS=Branchiostoma belcheri GN=SEC61G PE=3 SV=1 | 3 | 69 | 3.0E-20 |
sp|Q8I7D9|SC61G_CIOIN | Protein transport protein Sec61 subunit gamma OS=Ciona intestinalis GN=SEC61G PE=3 SV=1 | 3 | 69 | 1.0E-19 |
sp|Q9VWE9|S61G2_DROME | Protein transport protein Sec61 gamma-2 subunit OS=Drosophila melanogaster GN=Sec61gamma PE=3 SV=1 | 3 | 69 | 2.0E-19 |
sp|Q9V668|S61G1_DROME | Protein transport protein Sec61 gamma-1 subunit OS=Drosophila melanogaster GN=SEC61G1 PE=3 SV=1 | 3 | 69 | 3.0E-19 |
sp|P35179|SC61G_YEAST | Protein transport protein SSS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSS1 PE=1 SV=2 | 3 | 67 | 3.0E-19 |
sp|Q9SMP2|S61G3_ARATH | Protein transport protein Sec61 subunit gamma-3 OS=Arabidopsis thaliana GN=SEC61G3 PE=1 SV=1 | 3 | 70 | 2.0E-18 |
sp|Q54JV6|SC61G_DICDI | Protein transport protein Sec61 subunit gamma OS=Dictyostelium discoideum GN=sec61g PE=3 SV=1 | 13 | 68 | 6.0E-16 |
sp|Q8SRW9|SC61G_ENCCU | Probable protein transport protein Sec61 subunit gamma OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU05_0885 PE=3 SV=1 | 14 | 69 | 3.0E-08 |
GO Term | Description | Terminal node |
---|---|---|
GO:0016020 | membrane | Yes |
GO:0006886 | intracellular protein transport | Yes |
GO:0006605 | protein targeting | Yes |
GO:0009987 | cellular process | No |
GO:0051179 | localization | No |
GO:0051234 | establishment of localization | No |
GO:0008150 | biological_process | No |
GO:0071702 | organic substance transport | No |
GO:0071705 | nitrogen compound transport | No |
GO:0070727 | cellular macromolecule localization | No |
GO:0051641 | cellular localization | No |
GO:0045184 | establishment of protein localization | No |
GO:0051649 | establishment of localization in cell | No |
GO:0008104 | protein localization | No |
GO:0033036 | macromolecule localization | No |
GO:0046907 | intracellular transport | No |
GO:0110165 | cellular anatomical entity | No |
GO:0006810 | transport | No |
GO:0005575 | cellular_component | No |
GO:0015031 | protein transport | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 69 | 0.5 |
Domain # | Start | End | Length |
---|---|---|---|
1 | 40 | 62 | 22 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Hirsu2|8678 MADSVEGFIDVPREFLKDGLQFIHKCQKPDQKEFVKISQAIAIGFLTMGTVGYIVKLIHIPINNILVGAA* |
Coding | >Hirsu2|8678 ATGGCAGATTCGGTCGAGGGCTTCATCGACGTGCCCCGCGAGTTCCTCAAGGACGGGCTGCAGTTCATCCACAAG TGCCAGAAGCCCGACCAGAAGGAGTTTGTCAAGATCTCGCAGGCCATTGCCATCGGCTTCCTGACCATGGGCACC GTCGGCTACATCGTCAAGCTGATCCACATCCCGATCAACAACATCCTCGTCGGCGCCGCATGA |
Transcript | >Hirsu2|8678 ATGGCAGATTCGGTCGAGGGCTTCATCGACGTGCCCCGCGAGTTCCTCAAGGACGGGCTGCAGTTCATCCACAAG TGCCAGAAGCCCGACCAGAAGGAGTTTGTCAAGATCTCGCAGGCCATTGCCATCGGCTTCCTGACCATGGGCACC GTCGGCTACATCGTCAAGCTGATCCACATCCCGATCAACAACATCCTCGTCGGCGCCGCATGA |
Gene | >Hirsu2|8678 ATGGCAGATTCGGTCGAGGGCTTCATCGACGTGCCCCGCGAGTTCCTCAAGGACGGGCTGCAGTTCATCCACAAG TGCCAGAAGCGTGAGCCCGCCCCCCCCCCCGGCCGAGGAGGGGGGAGGAAGAGGAGATGGCCTCACCTCGTCCAG CCGTTGTTTCCTGCTCGCTGACGACGCACACCCGTGACAGCCGACCAGAAGGAGTTTGTCAAGATCTCGCAGGCC ATTGCCATCGGCTTCCTGACCATGGGCACCGTCGGCTACATCGTCAAGCTGAGTACGCCTGTGCCCCCCCTGCCA CGGTCCGTCGCCCGACGAGATGCTGACGCCAGGTCCTTGACCTCTGCGCAGTCCACATCCCGATCAACAACATCC TCGTCGGCGCCGCATGA |