Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8675
Gene name
LocationContig_581:62..931
Strand+
Gene length (bp)869
Transcript length (bp)798
Coding sequence length (bp)798
Protein length (aa) 266

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 8 257 2.0E-17
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 8 257 3.0E-17
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 32 264 7.0E-16
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 116 257 5.0E-15
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 45 254 7.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 8 257 2.0E-17
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 8 257 3.0E-17
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 32 264 7.0E-16
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 116 257 5.0E-15
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 45 254 7.0E-15
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 1 263 2.0E-14
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 86 260 4.0E-11
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 13 263 4.0E-11
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 45 263 4.0E-11
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 67 261 5.0E-11
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 13 262 4.0E-08
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 34 262 9.0E-08
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 42 262 2.0E-07
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 40 264 3.0E-07
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 46 260 5.0E-07
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 1 265 6.0E-07
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 46 262 2.0E-06
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 67 262 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 54 76 22
2 91 113 22
3 134 156 22
4 166 188 22
5 195 217 22
6 227 249 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8675
LAAAAELAFLACLRETCRPVLARRTGAVASPPSSSSVGRVLESSLRPVIMLSGSGVLMAVCLFSGVYFSFAYIIS
VTLPDILETVYGQPLAVQGPAFLSCSVGYCLSVILCNRTLDRTYIRLRKANNGVGLPEFRLPLAIVGALSLPVAV
LLYGCVPQLRLPLPVMLLSAALLAATLLLATLPTMAYVVDAFNGYPASAMTGLIFVRSLSSTFLPFLASPLITRF
GYARGFGVLSALCLCLCPIPMLVMRYGPKWRQRSEYSRDA*
Coding >Hirsu2|8675
CTGGCCGCCGCCGCCGAGCTGGCCTTCCTCGCCTGCCTGCGCGAGACGTGCCGGCCCGTGCTGGCGCGCCGGACC
GGGGCCGTCGCGTCACCGCCGTCGTCGTCGTCGGTCGGCCGCGTCCTGGAGTCGAGCCTGCGGCCCGTCATCATG
CTCTCCGGCTCGGGCGTGCTCATGGCCGTGTGCCTCTTCAGCGGCGTCTACTTCTCCTTCGCCTACATCATCAGC
GTCACCCTGCCCGACATCCTCGAGACCGTCTACGGGCAGCCGCTGGCCGTCCAGGGCCCTGCCTTTCTGAGCTGC
TCCGTCGGATACTGCCTGAGCGTCATCCTCTGCAACCGGACCCTCGACCGGACCTACATCCGGCTCCGCAAAGCC
AACAACGGCGTGGGGCTGCCCGAGTTTCGGCTGCCGCTGGCCATCGTCGGCGCGCTGTCGCTGCCCGTCGCCGTG
CTGCTCTACGGCTGCGTCCCCCAGCTGCGGCTCCCGCTTCCCGTCATGCTGCTGTCGGCGGCTCTGCTGGCCGCG
ACGCTCCTGCTCGCCACGTTGCCGACCATGGCGTACGTCGTAGATGCCTTCAACGGCTACCCGGCGTCGGCCATG
ACGGGCCTCATCTTTGTCCGCAGCCTTTCCAGCACCTTCTTGCCGTTCCTGGCGAGTCCCCTGATCACGAGGTTT
GGCTACGCACGCGGCTTCGGCGTGCTGAGCGCGCTCTGTCTGTGCCTCTGCCCGATCCCGATGCTGGTCATGCGG
TACGGTCCCAAGTGGCGGCAGCGGTCAGAGTATTCCAGGGATGCCTGA
Transcript >Hirsu2|8675
CTGGCCGCCGCCGCCGAGCTGGCCTTCCTCGCCTGCCTGCGCGAGACGTGCCGGCCCGTGCTGGCGCGCCGGACC
GGGGCCGTCGCGTCACCGCCGTCGTCGTCGTCGGTCGGCCGCGTCCTGGAGTCGAGCCTGCGGCCCGTCATCATG
CTCTCCGGCTCGGGCGTGCTCATGGCCGTGTGCCTCTTCAGCGGCGTCTACTTCTCCTTCGCCTACATCATCAGC
GTCACCCTGCCCGACATCCTCGAGACCGTCTACGGGCAGCCGCTGGCCGTCCAGGGCCCTGCCTTTCTGAGCTGC
TCCGTCGGATACTGCCTGAGCGTCATCCTCTGCAACCGGACCCTCGACCGGACCTACATCCGGCTCCGCAAAGCC
AACAACGGCGTGGGGCTGCCCGAGTTTCGGCTGCCGCTGGCCATCGTCGGCGCGCTGTCGCTGCCCGTCGCCGTG
CTGCTCTACGGCTGCGTCCCCCAGCTGCGGCTCCCGCTTCCCGTCATGCTGCTGTCGGCGGCTCTGCTGGCCGCG
ACGCTCCTGCTCGCCACGTTGCCGACCATGGCGTACGTCGTAGATGCCTTCAACGGCTACCCGGCGTCGGCCATG
ACGGGCCTCATCTTTGTCCGCAGCCTTTCCAGCACCTTCTTGCCGTTCCTGGCGAGTCCCCTGATCACGAGGTTT
GGCTACGCACGCGGCTTCGGCGTGCTGAGCGCGCTCTGTCTGTGCCTCTGCCCGATCCCGATGCTGGTCATGCGG
TACGGTCCCAAGTGGCGGCAGCGGTCAGAGTATTCCAGGGATGCCTGA
Gene >Hirsu2|8675
CTGGCCGCCGCCGCCGAGCTGGCCTTCCTCGCCTGCCTGCGCGAGACGTGCCGGCCCGTGCTGGCGCGCCGGACC
GGGGCCGTCGCGTCACCGCCGTCGTCGTCGTCGGTCGGCCGCGTCCTGGAGTCGAGCCTGCGGCCCGTCATCATG
CTCTCCGGCTCGGGCGTGCTCATGGCCGTGTGCCTCTTCAGCGGCGTCTACTTCTCCTTCGCCTACATCATCAGC
GTCACCCTGCCCGACATCCTCGAGACCGTCTACGGGCAGCCGCTGGCCGTCCAGGGCCCTGCCTTTCTGAGCTGC
TGTGAGTCGCCCCCCTCGCCGACGCAGATATGGCCCTTGCCTCGTTCCGTTGCGGCTGACGGGGGCGAGCAGCCG
TCGGATACTGCCTGAGCGTCATCCTCTGCAACCGGACCCTCGACCGGACCTACATCCGGCTCCGCAAAGCCAACA
ACGGCGTGGGGCTGCCCGAGTTTCGGCTGCCGCTGGCCATCGTCGGCGCGCTGTCGCTGCCCGTCGCCGTGCTGC
TCTACGGCTGCGTCCCCCAGCTGCGGCTCCCGCTTCCCGTCATGCTGCTGTCGGCGGCTCTGCTGGCCGCGACGC
TCCTGCTCGCCACGTTGCCGACCATGGCGTACGTCGTAGATGCCTTCAACGGCTACCCGGCGTCGGCCATGACGG
GCCTCATCTTTGTCCGCAGCCTTTCCAGCACCTTCTTGCCGTTCCTGGCGAGTCCCCTGATCACGAGGTTTGGCT
ACGCACGCGGCTTCGGCGTGCTGAGCGCGCTCTGTCTGTGCCTCTGCCCGATCCCGATGCTGGTCATGCGGTACG
GTCCCAAGTGGCGGCAGCGGTCAGAGTATTCCAGGGATGCCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail